,``@00ھ0\4 `@# ` "" $@` `T@   b@w"@H*/+  "bH  0  "  "  * " !` " @ %s: can't open device㿐@K#@  b("b( @ "   @`@)  @   "H@@%s: alloc failed%s: block table corrupt%s: read failure%s: short read㿐 `@    !@`  @ D ? c' / - + ,`2 @      @@ @`a@@?@2 @a aa @` @Ȳ@  ? Ċ`Ī@` Ē`IJ@` @ dvma_mapin㿘? #@(1? @@#1?dvma_mapout㿘 #@(1 @. 1㿘@ " ْ㿘 @  promprom0㿘  ` @ "H `  "  ` ""J  *@J` )*@Can't open device `%s' 㿘@   ` @ "H `  €b  $€b 2$   " @!X0   $   $`$` 㿘# bH`   ``*  `bH   '@`2`0`,6 * '@ 㿘  2& `& $& (   €5 " '@ 㿘 "H  @@ 0(@  㿘  @ $ ? `$ *㿐 "H/  0T@㿘  㿘 "H`t€Invalid controller number prom_iopen: "%s" error=%d 㿘) " ?N  @  "bPbP$` $`$`$`$`$`$` $`$$`($`,$`0$`4$` $`  $` $`  @ `+  " * @F $`0 "$`4 " @$` @ 2" &  %"   @  㿘# b  @ 4 "$b  & 4$b prom_mapin: length=%dprom_mapin: invalid maptype %d㿘  *`@   "H@ Ę    L         "`@{` `  @   8 <?*  Ș آ&@  `   Ȱ@㿘?( ,1 \&"H H L` T ` X P d l$ p  t @  .@ ДЖ ? * `:```?  `Ԕ "`"     А?"  㿘 b'H'L'P'T 'X "b@0H @  exit㿘 !@ ( 㿘!  !X'L'P'T'X$"@L"*㿘 'H'L'P'T'X @ H㿘  @8N@`N@`%` N@`|`  `*` € @L` L   ?,@` < ,L L  LL 4 L  ` >0 `L` L` N@ ` - @L N@ @C N@ @: N@ 0 x  @, N@ % w ls4l404x444444444444444d44444444444@444444440123456789abcdef㿈  @ @,@"  ?L?|/-\㿘  ؀`  "  a8J@ #" @ @   @ *0   @ *`( `6: `6 `6* " * "` " 2 "` "`" "`: `6:``" `2 2*@   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &  @   (@  +` @ (`3`@!@ v"   *3`"  "0e+`@  e# */3` 3`  3` 3` P M 3` G D  3` 3` ; 8 3` 2 / 3`  3` 3` #   3`    3` 3`    3`   &" bootxx /P/`/p////(4444444H44\4   4444#4p,4\74=4F4M4 pV 4 c4m4t4 |4 4H44 4(4@4 4H @ <   @@<>A&f>/<><>../../instbinH!a<&%<&%< h@ 8a<'V<'V< hA0a<) <) < hBc !<*Q<*Q< h6@>B!<,<,< h6A0N!<-L<-L< h6B:aa<2<2< hR-3!<4s<4s< h6Py!<6<6< !6Q/!<8ـ<8ـ< !6R,a<:i<:i< !` ,a<1-<1-< !aOa<<< !bR)@!<Ĵ<Ĵ< !6`:9!<'<'< !6a:0+!<р<р< !6bPB@a< < < !p Ga< < < !qw4a<沀<沀< !rK"!<v<v< !6pq!<z9<z9< !6q<!< < < !6r<:!<9<9< !yˀ:!<<< !y%!<e<e< !yS7!< /< /< !y֏u!Xa<,<,<+ ?!<.}<.}<+*;fa<0G<0G<+ C!<2<2<+* a<4s<4s<+ b!<6=<6=<+*R^a<8ـ<8ـ<+ 6I!<9<9<+*unKa<<<+ `c!<bZ<bZ<+* a<Ĵ<Ĵ<+ !!<w<w<+*Ca<X;<X;<+ f!< < <+*a< X< X<+ ,;!<N<N<+*a<v<v<+ m!<z9<z9<+*ja<C<C<+ v4!<W<W<+* ͠xya<p<p<+ M !<9<9<+* +a<8<8<+ }A!<e<e<,* a< /< /<+ !<"<"<,* mZa<$[܀<$[܀<+ mqS!<&%<&%<,* 7qa<(<(<+ 2b!<*Q<*Q<,*a<,<,<+ A|!<.}<.}<,*ܢa<0G<0G<.} ;7!<2b<2b<.}*HRa<3%<3%<.} 鮣!<6=<6=<.}*ua<8C<8C<.} )@!<9<9<.}* -a<1-<1-<.}  Uj!<bZ<bZ<.}*na<,<,<.} Lj!<<<.}*>Ca<'<'<.} e|u!<р<р<.}*ta< !< !<.} Op!< < <.}*a< < <.} 1!<沀<沀<.}*a<v<v<.} "!<<<.}*&bfa<f<f<.} >t!<<<.}*ӕa<t<t<.} ( !<<<.}*:la<e<e<.} Ժ;!<(<(<.}*w-a< U< U<.} ͞R!<"<"<.}* a<#F<#F<.} {!<% <% <.}*la<&6<&6<.}  X!<(<(<.}*Za<)'<)'<.} Ky!<,<,<.}*Ka<-D<-D<1xˀ ݧH!<!<><><4s*>Ta<p<p<4s ?C!<9<9<4s*?9_a<<<64̮&!<e<e<6{l\a<<<6]!< U< U<6{MSa<"<"<6 #!<$[܀<$[܀<6{OKa<% <% <6ɭ!<'V<'V<6{Ca<) <) <60 O!<*Q<*Q<7n{ya<,<,<6S3-!<-D<-D<7n{Q)Zoa /tmp/fstab munge_fstab < /tmp/fstab fi mount_fs "-o async" mount | while read line; do set -- $line if [ "$3" = "/" -a "$5" = "nfs" ]; then echo "You appear to be running diskless." echo -n "Are the install sets on one of your currently mounted filesystems? [n] " getresp n case $resp in y*|Y*) get_localdir ;; esac fi done echo '\nPlease enter the initial password that the root account will have.' _oifs=$IFS IFS= resp= while [ -z "$resp" ]; do echo -n "Password (will not echo): " stty -echo getresp -n stty echo echo _password=$resp echo -n "Password (again): " stty -echo getresp -n stty echo echo if [ "${_password}" != "${resp}" ]; then echo "Passwords do not match, try again." resp= fi done IFS=$_oifs md_questions install_sets $THESETS # Copy in configuration information and make devices in target root. cfgfiles="fstab hostname.* hosts myname mygate resolv.conf kbdtype" echo if [ -f /etc/dhclient.conf ]; then echo -n "Saving dhclient configuration..." cat /etc/dhclient.conf >> /mnt/etc/dhclient.conf echo "lookup file bind" > /mnt/etc/resolv.conf.tail cp /var/db/dhclient.leases /mnt/var/db/. # Don't install mygate for dhcp installations. # Note that mygate should not be the first or last file # in cfgfiles or this won't work. cfgfiles=`echo $cfgfiles | sed -e 's/ mygate / /'` echo "done." fi cd /tmp echo -n "Copying... " for file in $cfgfiles; do if [ -f $file ]; then echo -n "$file " cp $file /mnt/etc/$file rm -f $file fi done echo "...done." remount_fs _encr=`/mnt/usr/bin/encrypt -b 7 "${_password}"` echo "1,s@^root::@root:${_encr}:@ w q" | ed /mnt/etc/master.passwd 2> /dev/null /mnt/usr/sbin/pwd_mkdb -p -d /mnt/etc /etc/master.passwd dd if=/mnt/dev/urandom of=/mnt/var/db/host.random bs=1024 count=64 >/dev/null 2>&1 chmod 600 /mnt/var/db/host.random >/dev/null 2>&1 # Perform final steps common to both an install and an upgrade. finish_up  . .. bin dev etc mntmnt2lsbinl tmp usr varinstbin install.subinstallupgradeR bsdX.profileMNhY install.mdhZbootB0#!/bin/sh # $OpenBSD: upgrade.sh,v 1.31 2002/04/13 21:03:31 deraadt Exp $ # $NetBSD: upgrade.sh,v 1.2.4.5 1996/08/27 18:15:08 gwr Exp $ # # Copyright (c) 1997-2002 Todd Miller, Theo de Raadt, Ken Westerback # All rights reserved. # # Copyright (c) 1996 The NetBSD Foundation, Inc. # All rights reserved. # # This code is derived from software contributed to The NetBSD Foundation # by Jason R. Thorpe. # # Redistribution and use in source and binary forms, with or without # modification, are permitted provided that the following conditions # are met: # 1. Redistributions of source code must retain the above copyright # notice, this list of conditions and the following disclaimer. # 2. Redistributions in binary form must reproduce the above copyright # notice, this list of conditions and the following disclaimer in the # documentation and/or other materials provided with the distribution. # 3. All advertising materials mentioning features or use of this software # must display the following acknowledgement: # This product includes software developed by the NetBSD # Foundation, Inc. and its contributors. # 4. Neither the name of The NetBSD Foundation nor the names of its # contributors may be used to endorse or promote products derived # from this software without specific prior written permission. # # THIS SOFTWARE IS PROVIDED BY THE NETBSD FOUNDATION, INC. AND CONTRIBUTORS # ``AS IS'' AND ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED # TO, THE IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR # PURPOSE ARE DISCLAIMED. IN NO EVENT SHALL THE REGENTS OR CONTRIBUTORS BE # LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, SPECIAL, EXEMPLARY, OR # CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT LIMITED TO, PROCUREMENT OF # SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, DATA, OR PROFITS; OR BUSINESS # INTERRUPTION) HOWEVER CAUSED AND ON ANY THEORY OF LIABILITY, WHETHER IN # CONTRACT, STRICT LIABILITY, OR TORT (INCLUDING NEGLIGENCE OR OTHERWISE) # ARISING IN ANY WAY OUT OF THE USE OF THIS SOFTWARE, EVEN IF ADVISED OF THE # POSSIBILITY OF SUCH DAMAGE. # # OpenBSD installation script. # In a perfect world, this would be a nice C program, with a reasonable # user interface. # install.sub needs to know the MODE MODE=upgrade # include common subroutines and initialization code . install.sub # Remove 'etc' set from THESETS. It should be installed # manually, after the upgrade. Note that etc should not # be the first or last set in THESETS, or this won't # work! THESETS=`echo $THESETS | sed -e 's/ etc / /'` # XXX Work around vnode aliasing bug (thanks for the tip, Chris...) ls -l /dev > /dev/null 2>&1 while [ "X${ROOTDISK}" = "X" ]; do getrootdisk done # Assume partition 'a' of $ROOTDISK is for the root filesystem. Confirm # this with the user. Check and mount the root filesystem. resp= while [ "X${resp}" = "X" ]; do echo -n "Root filesystem? [${ROOTDISK}a] " getresp "${ROOTDISK}a" _root_filesystem=/dev/`basename $resp` if [ ! -b ${_root_filesystem} ]; then echo "Sorry, ${_root_filesystem} is not a block device." resp= fi done echo -n "Checking root filesystem (fsck -fp ${_root_filesystem}) ... " if fsck -fp ${_root_filesystem} > /dev/null 2>&1; then echo "OK." else echo "FAILED.\nYou must fsck ${_root_filesystem} manually." exit 1 fi echo -n "Mounting root filesystem ... " if mount -o ro ${_root_filesystem} /mnt; then echo "Done." else echo "ERROR: can't mount root filesystem!" exit 1 fi # fstab and hosts are required for upgrade for _file in fstab hosts; do if [ ! -f /mnt/etc/$_file ]; then echo "ERROR: no /etc/${_file}!" exit 1 fi cp /mnt/etc/$_file /tmp/$_file done # Start up the network in same/similar configuration as the installed system # uses. cat << __EOT The upgrade program would now like to enable the network. It will use the configuration already stored on the root filesystem. This is required if you wish to use the network installation capabilities of this program. __EOT echo -n "Enable network? [y] " getresp y case $resp in y*|Y*) if ! enable_network; then echo "ERROR: can't enable network!" exit 1 fi cat << __EOT You will now be given the opportunity to escape to the command shell to do any additional network configuration you may need. This may include adding additional routes, if needed. In addition, you might take this opportunity to redo the default route in the event that it failed above. __EOT echo -n "Escape to shell? [n] " getresp n case $resp in y*|Y*) echo "Type 'exit' to return to upgrade." sh ;; esac ;; esac echo "The fstab is configured as follows:\n" cat /tmp/fstab cat << __EOT You may wish to edit the fstab. For example, you may need to resolve dependencies in the order which the filesystems are mounted. NOTE: 1) this fstab is used only during the upgrade. It will not be copied into the root filesystem. 2) all non-ffs filesystems, and filesystems with the 'noauto' option, will be ignored during the upgrade. __EOT echo -n "Edit the fstab with ${EDITOR}? [n] " getresp n case $resp in y*|Y*) ${EDITOR} /tmp/fstab ;; esac echo # Create a fstab containing only ffs filesystems w/o 'noauto'. munge_fstab < /tmp/fstab if ! umount /mnt; then echo "ERROR: can't unmount previously mounted root!" exit 1 fi # Check filesystems. echo "Checking non-root filesystems..." if ! check_fs $_root_filesystem; then # Prevent check_fs() invocation in cleanup_on_exit from fsck'ing. # Remember /etc/fstab is a link, /tmp/fstab.shadow is the file! rm /tmp/fstab.shadow fi echo "...Done." if [ ! -f /etc/fstab ]; then exit 2 else # Mount filesystems. mount_fs fi # If Xfree86 v3 directories that would prevent upgrading to XFree86 v4 # are found, move them and replace them with links that the upgrade # can replace with new values. ( if [ -d /mnt/usr/X11R6/lib/X11 ]; then cd /mnt/usr/X11R6/lib/X11 for xf3dir in twm xkb xsm xinit rstart; do if [ -e $xf3dir -a ! -L $xf3dir ]; then mkdir -p XF3 mv $xf3dir XF3/. ln -s XF3/$xf3dir $xf3dir fi done fi ) echo -n "Are the upgrade sets on one of your normally mounted (local) filesystems? [y] " getresp y case $resp in y*|Y*) get_localdir /mnt ;; esac # Install sets. install_sets $THESETS # Copy in configuration information and make devices in target root. ( if [ -f /mnt/etc/sendmail.cf -a ! -f /mnt/etc/mail/sendmail.cf ]; then echo "Moving /etc/sendmail.cf -> /etc/mail/sendmail.cf" [ -d /mnt/etc/mail ] || mkdir /mnt/etc/mail mv /mnt/etc/sendmail.cf /mnt/etc/mail/sendmail.cf ed - /mnt/etc/rc << __EOT 1,$s/etc\/sendmail.cf/etc\/mail\/sendmail.cf/g w q __EOT fi ) # Perform final steps common to both an install and an upgrade. finish_up    b  @D, @' $⠜+#@  /P@Z / "%< %< @<@`@4`Ƃd??/usr/libexec/ld.soNo ld.so Failure reading ld.so Bad magic: ld.so Cannot map ld.so crt0: update /usr/libexec/ld.so ld.so failed h! Р"$   Ŗ ?$   `""ܒ      ؐ        ?@ ?# @! ?a ?@ ?# @ `     | ??"  #\@ #`?# @!  3 @@! -? ?c@  ̀@ ! @ ̀@? ?c@ ! @   @! @     #d#h  Ŕ  ( ? $ ( !    ?#\#`ؔ@ ?# @!   a ?@  ?#  ?FB?? ?# ! 2 ?1@! ,? ?c@  ̀@2 ?@ ̐ ? ?c@ ! @" @! @2 #?:  ?# !  ?/ @! )? ?c@  ̀@ ? @ ̐ ? ?c@ ! @   @! @   #d#h   Ř u ?  ( o  l 䀣 !  #\܆    #d#h`#`  R ?2   ( L  I  bP< $ $ $ $  ` ?2 @  !1 `  ?2   h %  "  ""`@z"܁㿘"ܒ€ 㿘"܀``@?㿘"ܒ€ 㿘"ܒ ?Service unavailable㿐"܀     ?1 !P  @Z*`:` J " %s: %s not compiled in instbin㿘@a@ J 2@@H@@gG /  @P @`"@ 2      a@)!@"㿘 ?@?`ÔUsage: %s ..., where is one of: %s㿘  c @!P`@ `@) + @3@  O4@#X@@c``@ @ޒ#X@1Ӑ hostnamedmesgexprmvsleep-shshkshsedmkdirmtshutdownstringsrmtipgetoptmount_mfsnewfsinitsortfsckfsck_ffschrootchflagschownchgrpchmodgzcatgunzipgzipcutcpedhaltrebootffsmount_ffsdhclientftprouteinstallbootslattachmknodrshumountbasenamefgrepegrepgrepnfsmount_nfsmorelessresettsetsumcksumsysctllsifconfigcatpingcpiotarpaxdisklabellnsttyvibuildsyncmountnetstatdfcd9660mount_cd9660dd㿘@!05/5$/7/5@/5l@@/5/5/5/5 /6@@/6skipseekofobsifibsfilescountconvcbsbsout of memoryunknown operand %sno value specified for %s%s: illegal argument combination or already setbs supersedes ibs and obsrecord operations require cbscbs cannot be zerocbs meaningless if not doing record operationsbuffer sizes cannot be zerobuffer sizes cannot be greater than %useek offsets cannot be larger than %qd㿈 "c"` x"  # $b%C+) 5 7 / - 3 @ $@.Ր @} = 2,b @.̐  L bb0@.Ð  ' @)蔒 h @.  "`P@.  €$h  $h`@"@ $hh` @ @xΐ h` `@. "` `@.| `p!4 !"@!   !4$h%`p `@.` "` # `@.W  x%`p#  `x` % a@.F  ? @  2` $ 8 `  @`   `$   aP @.?㿘@@㿘@"c"㿘@"b㿘@ "c8?"c8㿘@R"b㿘 h`@"c 㿘 h`@"` 㿘@:㿘@: 7 Fp77 Gp7 Hp777x7h Cp7X Dp7P Ep7H7@78707(unblockucasesyncswabosyncoldibmoldebcdicoldasciinotruncnoerrorlcaseibmebcdicblockascii,unknown conversion %s%s: illegal conversion combination㿈 ,'D) % !' # 1D@w˒#'8  @ @-< h`"`c@-3 ` `"h& lD ߐD㿘@@%s%s: illegal numeric value%s: %s㿐@ ?2"`@v 2J"`@, `k`m`b". `w . . . 8 'J`x 4``*2 @2"! @9 "@, "`@, 㿐 @Gm    "`@v 2K"`@,  k m b .J w(J4`,  ,` 4`,  ,` 4` ,  ,`4`,  ,`& 2 @" 'J`x 4#`%`*2  @ @"! @ɷ "@,> "`@,9 㿘 l c  "@  x  *xc``$   $ @   $`$` 㿘"?`$)#  #     ##" "  #@&"@ ##?"`"`%# x "@ #@ '`@8 l    +@ `  0 +@`    #`*`#` " "`?"` l   @." * x` " "` %` #  #`? "`  #` ? %"` x`` ` $` $`@> ` `## @ " 㿘#` %!@ x` "@ "@&A `l `` `   ! "@.9" x" "㿘 l+c  ??  @? ?,@ c@ <c x   @?*" ?   " " " @%@$$ $*@` $@  @ " % c   c@%ʒ"@ c  $ %s: short input record㿘c  2  @t"pc  %   c ? *c "?c x$  `@%``@$`$`x `"* "㿘@ @9a@,# a@, @#Lc8? 3R@Vb??&b@@+א stdin%sfiles is not supported for non-tape devicesstdoutinput bufferoutput buffer㿘#    $  $ @ $  `@t @R"`   `@*  x   @ $ $ ')`h# "& @v! $  h" & @j! $ `$ x` x` @s’`x@ h @2`` @)Ӑ? $`H@s $x! "@*"@)@  $`"@)@ $x`X@s xx`$"`$ ` " @  $@ h@& h   h   @ݔ     @  h"@L`!&b Hhl *  +@ ( 5h"hl *  +@ ( $h Hh  *  +  h"h  *  +  h l`@  @,` h `@s  <     a@,     @"5 ?   "`  & 㿘 )c x#@/1#8#@`  h -` @+` @+`  @"  h$ 6. h$2   @r  @rڐ@K  h      @!ܔ @h @rƐh``$` #@@  $`%#@  h $ #@@  $ %#@ $  $  $ ` %`h` `@w&`$`@@ `"`` %``@w`` p@€$`x㿘`p x@Z!4@  ܀@ h ! x` x@  " @+V  x@+Q  x`"` x `@ %s: end of device%s: short write on character device%s: short write on tape device㿘 x  x`` x35/+-  ?#  x`   2 `` "@r0` x` "$` @'@!' c@ @'ܐ "` @q c@  > B; Ǥ@2   #  x  " &   #    x@""@  x  & %u+%u records in %u+%u records out %u odd length swab %s blockblocks%u truncated %s %qd bytes transferred in %ld.%03ld secs (%0.0f bytes/sec) Ȑ@ c`c`" '"@ 'Вb@ ?R*"@ "X*`" *  *  ' B?8 ?8`   d #\@@D @*'@ $ "Ѐ "" @ d-`@*%% #@ (" "" @В d-`@*o%%`@`!#@|##\@#Rb` B d8-` ª`@;`@*N%%@*P 㿘! g"$"㿘a@( %sskip reached end of input㿘c 2   @     @ߖ ?CAa@p  9 +-@  "  &!D?D? Rb ?"b@&  hd @pa a@p` 㿐 x      @鸔      @ ?vt a@p=   $  '7a@) c a@p,    X $ T`x `x@v  4A6  a@p   7 'a@)”? a@p  D 4`x, $ (`x`x @S    a@o  D 4`x $ `x0  D4`x $`x㿘@`VVVVVVVVVVVxVp Vhupdateunionrdonlysuidexecdevatimeaccesstimeautorwrogroupquotauserquotaegjo:Rcd9660%s: Filesystem not supported by kernel%s on %s @ '+) '%/5 0* `@€    "@ @w@耢??㰓* & @ @h@?` '' ' '''@%L  "`-b@%6 c @o @& WWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWWW|WWWWWWWWWWusage: mount_cd9660 [-egjR] [-o options] special node 㿘aX@v!@&k ,-o %s: option not supported㿘@א  @n 1' n L  o  @r = 2*`"@ 2   @2    &*@&a@$  @Dᰠ 2L@$Đ㿘@9hiklnPt:only one -t option may be specified.-i is incompatible with -Pretrieving information on mounted file systems%s%s is not a local file system%s mounted as a %s file system0@5%!';/-S+ )+9 $&* @@€ $ $ А $̐ $ $Ȑ '` %Đ "`H c@$, @b@J@Z#?Ґ?#̑*@` & ` @nN@@2@Q  2@c`@m  !@ Y@@ `R' @@  @@ @@m#=`< @ @2 @@@@ 2-`%a@)@ !`  @@@m`@z D 2 ac@@mD` @@m#`@  @`  @& 4?a` $  @ǔ0@`@% \t\\\\\\\\\\\\\\\\\\\\\\\\0\@\\L\\\\h\\\\\\㿐@  @6  @ֽ ` T@! 㿘S H  ``?  #@    2`@ empty type list㿘 N  n`@#  N  o "` "  %S  @ʨ , ` @"*  $H @lҒ $@ , `$@  @ʑ , 2*@, $@㿘 `S H`  Ā` @ ., ' D @"!s  Ā`@%T! T@ a!!S&P' S. X SS`B# h SSpB x SSB  SSB B 8 0B %5.0f%cBKMGTPE %5.1f%c㿐??S BS@Jx#0  #J  #@Jk 0#J  #@Jc 㿐 ' S B B? ' B?  D?%-*.*s %*u %8u %8d %5.0f%% %7u %7u %5.0f%% %s 㿐  @J#!(    " F ` !0@6 @L@'  @D@' ` @ @8@& @0@'` @ @$@!  @@'~ @IҖ!@' S`B'S`D?@  @I `̀ (  !P`"@ ' SญB'`S`BS B?@  @I @I!h!p@I T Size%-*.*s %s Used Avail CapacityFilesystem1K-blocks%-*.*s %s Used Avail Capacity iused ifree %%iused Mounted on 㿐 Ȁ` @$|' @@IJ Ѐ`  P$'@$g'@X `@@I0 ̀`"@I( @I% ` !1024-blocks 512-blocks%-*.*s %s Used Available Capacity Mounted on %-*.*s %*d %10ld %11d %5.0f%% %s x Ѐ`!$!Ц"@$!@@H`n T ` ``" 2'@  ?S' ȉ ‰ F?@#`"` @6 `@@%` ` `@@&S` ` @6 `@@ #\`@ݒ@&?#\`  @  @А@` #` @Ȓ@&*`#`#l#d#h@Hxa!a㿘@ @j@#?@^ @  @  ?  df: %qd: %s 㿘 @*@B "!`  @k@}  usage: %s [-hiklnP] [-t type] [file | file_system ...] 㿘P <a@b!@!W ffs㿘   F\!T@"&;?4&0&(& 8@%̘ d &<(#  ; @<  @X d$"@&@%z,?&Ȑ&& ;&$ "T@ Z@ ZDb@ɿ  lfs㿘#` d `!b@"&E?  d& &   "@ 2 &    $"@ 2 & T @%1" @$ d& $ 8 &  " : && (& d@% $&& &$ߐ #HT@? Z@; ZDcP@c  ext2fs㿘- $$  ;`8#S@H?`L (&B?`$*&`4 * &@$.`(``` $@$%4 ?@$`@$Ȑ$& ` &`"@ &&`& &&$  T@ Z@ݔ ZD`@  㿘@Do$OpenBSD: if.c,v 1.29 2002/02/16 21:27:50 millert Exp $ifnet: symbol not defined %-7.7s %-5.5s %-11.11s %-17.17s NameMtuNetworkAddress%10.10s %10.10sIbytesObytes%8.8s %5.5s %8.8s %5.5s %5.5sIpktsIerrsOpktsOerrsColls %sTimeDrop%-7.7s %-5ld %-11.11s none%-15.15s %-17.17s %-*.*s %25s %-17.17s %25s %-*.*s %xHipx:%-8s%-17s atlk:%-12s%-12s ns:%-8s (%d)%x%c%10lu %10lu%8lu %5lu %8lu %5lu %5lu %4dX`@Fa"0Y "@0SX@Fe  NXbА"ؖ@FI"b@   "c@F=#c08@#H@F.cPc  #X@F$c` `8  #X@Fch a``?"`!` * %!`@ ` `% @F ؀ H4@$ !|/W`$@* 䀦` @aT` *,@`,@,!h`|h l p t x ` WR`8 Ĕ" \#p@EH``!#@E##@Ex@@E ` " ``*"*` €!#@E##@EVp@X``  @   @  ! @Ev#@X `` @   @   #@Eaa "Ԁ #! @Ec $@W c@EO#4  p`? ?  '`` $`$`,` ,` @X`` @ Z  @ U ! @E##@Y`` @ D  @ ?  #@Ea  #%@E , @X .``  @   @ ؒcЖ @D p? `* * @' `* `* `* @U@[ِ@Dɐ#! @ZC!  @^@D!  @^ 4?`# `*` '7 @)@[@D ! @Y`0@D# ```` 2 ` `! #@㗐@@DEp  @ `@Dv 8 @ @ @ 8L@ "8 ?  @ @ `  .@DZ? " ?!` `?`$``@ !`* %!`@ ?p@ | H@D3 h Xlpt@D)x WR@D" x`8 @D x!`` ?"`!`* %!`@ ``)w|8w|8|8|8{P|8|8|8|8|8|8|8|8|8{|8{|8|8|8|8zx%s%s: %s: unknown interface %7.7s in %8.8s %6.6s out %5.5s %5.5s in %5.5s%5.5s out %5.5s %5.5s %5.5s %7.7s in %8.8s %6.6s out %5.5stotal %5.5s in %5.5s%5.5s out %5.5s %5.5s%10.10s %8.8s %10.10s %5.5sbytespacketserrscollsdrops %10.10s %8.8s %10.10s %5.5s %8.8s %5.5s %8.8s %5.5s %5.5s%10lu %8.8s %10lu %5.5s %5d %10lu %8.8s %10lu %5.5s %8lu %5lu %8lu %5lu %5lu㾨'D@C     a| ?'"H )4'  7"5-1 +' @ݒ  "p@ؖa|`"`0@΅ "`0਀@ $ @CL ؀ 2 P <a|!@釒bx@| @ D"c@@  ☒@C   8b @C  8 @C "H$ *` *  *  *  :  @   @B   8c   @B  8 b@Bݒ H@:a`&`&`&`&`&` &`$&`(&`,`0@*&`a``?"`a` * %a`@b @  chH @B  8#pxc  @B 8 b@BH$ *` *  *  *  :  !@  ch @B  8#pxc  @Bu 8 b@Bma``?"`a` * %a`@ @sa` `$ $ $ $ $ $ $$ ($ ,rbH@o" @BT ؀ ` @.h@ |`В" ` @B2#@  8`Xh`" l`" p`# t`$#@ x`(@B  8 `,@B" h&`|&`l&`p&`&` t&`$x&`(&`,  $ `  $ `  $ `  $ `   $ `$ $@$ $`( ( $ ( ,`,$@$ ,`0@  bH$ *` *  *  *  :  ,@    " # @A˜  8 ` "  "  #  $$#@  ((@A  8  ,,@A" a``?#`  $ $ $ $  $ $ $ $ $$  ($$ ,$($,a` * %a` @$ @a`c`'@ D @G I  $OpenBSD: inet.c,v 1.58 2002/02/19 21:11:23 miod Exp $TIME_WAITFIN_WAIT_2LAST_ACKCLOSINGFIN_WAIT_1CLOSE_WAITESTABLISHEDSYN_RCVDSYN_SENTLISTENCLOSED㿘@V 㿘@O tcp??? Active Internet connections (including servers)%-*.*s %-5.5s %-6.6s %-6.6s %-18.18s %-18.18s %s PCBProtoRecv-QSend-QLocal AddressForeign Address(state)%-5.5s %-6.6s %-6.6s %-22.22s %-22.22s %s %*p 6%-5.5s %6ld %6ld %d %sp'L  "@a`?@@Ӕ ""`'9"7"5"L 3 a`!3`!a  0@JL'䀢  8`@@ <p@@!#@%"@@!a`"@@!Вa`` ?"`a`* $a`@ "l`""8#\"b@"""#`Pa" #d#h  "(@@^0 ""bh"8b@"#\"(0@@PP l  <@@F ` @@@`! @"b@R"`t`L@@-`a 6$@*  4@*  0@  4 @  !p d* 2` S""@@: a`:aL@"@?Ȓa`` ?"`a`* $a`@  @?  @,"@?!%s: %u packet%s sent %u data packet%s (%qd byte%s) %u data packet%s (%qd byte%s) retransmitted %qd fast retransmitted packet%s %u ack-only packet%s (%u delayed) %u URG only packet%s %u window probe packet%s %u window update packet%s %u control packet%s %u packet%s hardware-checksummed %u packet%s received %u ack%s (for %qd byte%s) %u duplicate ack%s %u ack%s for unsent data %u packet%s (%qu byte%s) received in-sequence %u completely duplicate packet%s (%qd byte%s) %u old duplicate packet%s %u packet%s with some dup. data (%qd byte%s duped) %u out-of-order packet%s (%qd byte%s) %u packet%s (%qd byte%s) of data after window %u window probe%s %u packet%s received after close %u discarded for bad checksum%s %u discarded for bad header offset field%s %u discarded because packet too short %u discarded for missing IPsec protection %u connection request%s %u connection accept%s %u connection%s established (including accepts) %u connection%s closed (including %u drop%s) %u embryonic connection%s dropped %u segment%s updated rtt (of %u attempt%s) %u retransmit timeout%s %u connection%s dropped by rexmit timeout %u persist timeout%s %u keepalive timeout%s %u keepalive probe%s sent %u connection%s dropped by keepalive %u correct ACK header prediction%s %u correct data packet header prediction%s %u PCB cache miss%s %u SYN packet%s received with same src/dst address/port h h#@>>"@>H!0`!#!`  !#"@>X@>)  @!#!`4!#"@>B@>>@>    $@!#!`4(!#"@>% @>!$@=(, (!` 0(%#@>  @=۔0  耢 !#!`4 8!##8@=@=Œ8`!#!`4 4!##`@=@=4`!#!`4  max ip packet size %lu tunneling packet%s that can't find gif %lu datagram%s with bad address in header %lu input datagram%s checksum-processed by hardware %lu output datagram%s checksum-processed by hardware  x@8J |#"@88x !*!`4 |!* 8@8V@8'| !*!` !* X@8E@8*!`4* x@8  *!`4* @7 *!`4* @7 *!`4* @7 Ȁ*!`4*!@7Ւ Ѐ*!`*!0@7Ȓ  !*!`4 !*!X@7@7 !*!`4 !*!x@7Ր@7؀ !*!`4 !*!@7Đ@7 !*!`4 !*!@7@7 !*!`4 !*!@7@7s !*!`4 !*"@7@7b !*!`4 !*"8@7@7Q !*!`4 !*"h@7o@7@ !*!`4 !*"@7^@7/ !*!`4 !*"@7M@7 !*!`4 !*"@7<@7 Ԁ !*!`4 !*"@7+@6 !*!`4 !*#@7@6̀ !*!`4 !*#P@7 @6ڒ !*!`4 !*#@6@6ɒ !*!`4 !*#@6@6Ā !*!` !*#@6֐@6܀*!`*#@6  !+!`4 !+ @6@6䀦 !+!`4 !+ H@6@6x耦 !+!`4 !+ x@6@6g쀦 !+!`4 !+ @6@6V !+!`  @6u@6Faddress mask replyaddress mask requestinformation request replyinformation requesttime stamp replytime stampparameter problemtime exceededrouter solicitationrouter advertisementecho#7#6routing redirectsource quenchdestination unreachable#2#1echo reply %lu call%s to icmp_error %lu error%s not generated 'cuz old message was icmp Output packet histogram: %s: %lu %lu message%s with bad code fields %lu message%s < minimum length %lu bad checksum%s %lu message%s with bad length Input packet histogram: %lu message response%s generated ( @5!l#"@5 !-!`4 !-"p@5@5| !-!` S!-"@5@5kS!x P)-'-  (  `"@5Z"Ȣ @5U? 8 2!-!`4 @1!1!`4 !1"@1-@0!1!`4 !1"8@1@0!1!`4 !1"h@1 @0ܒ!1!`4 !1"@0@0˒!1!`4 !1"@0@0!1!`4 !1#@0ؐ@0Ā!1!`4 !1#H@0ǐ@0Ѐ!1!`4 !1#@0@0耤!1!`4 !1#@0@0v!1!` !1#@0@0e܀ !` %2@0 @0Q䀒 !` %20@0n @0> %u packet%s were dropped because of no interface/bridge information %u packet%s dropped for other reasons %u input ethernet-in-IP packet%s %u output ethernet-in-IP packet%s h @0 0#"@0Ȁ!1!`4 !1!@0!@/̀!1!`4 !1"@0@/Ѐ!3!`4 !3!0@/@/ВԀ!1!`4 !1!@/@/؀!3!`4 !3!x@/ݐ@/܀!3!`4 !3!@/̐@/!3!` !3!@/@/쀒 !` %2@/ @/x !` %20@/ @/e %u input ESP packet%s %u output ESP packet%s %u packet%s with bad encryption received %u packet%s with bad payload size or padding received @ P@/B X#"@/0̀!4!`4 !4 @/N@/Ѐ!4!`4 !4 @/=@/!1!`4 !1!P@/,@.!1!`4 !1!@/@.쀤!1!`4 !1!@/ @.ے!1!`4 !1!@.@.ʒ!1!`4 !1"@.@.!4!`4 !4 @.א@.Ā!1!`4 !1"8@.Ɛ@.!1!`4 !1"h@.@.!1!`4 !1"@.@.u!1!`4 !1"@.@.dȀ!1!`4 !1#@.@.S!4!`4 !4!@.q@.BԀ!1!`4 !1#@.`@.1耤!1!`4 !1#@.O@. !1!` !1#@.>@.܀ !` %2@.+ @-䀒 !` %20@. @- %u total input packet%s %u total output packet%s %u packet%s with possibly spoofed local addresses %u protocol family mismatches %u attempts to use tunnel with unspecified endpoint(s) h @- 0#"@-Ȁ!5!`4 !5"@-Ő@-̀!5!`4 !5"@-@-Ѐ!1!`4 !1!@-@-t耤!1!`4 !1!@-@-c쀤!5!`4 !5"@-@-RԀ!1!` !1"@-p@-A܀ !` %2@-] @--䀒 2!` %20@-I @-!5!`4 !5#@-7@-􀤠!5!` # @-'@, %u input IPCOMP packet%s %u output IPCOMP packet%s %u packet%s that failed (de)compression processing P  @, H#"@,Β̀!6!`4 !6"H@,@,Ѐ!6!`4 !6"h@,ې@,!1!`4 !1!P@,ʐ@,!1!`4 !1!@,@,쀤!1!`4 !1!@,@,y!1!`4 !1!@,@,h!1!`4 !1"@,@,WĀ!1!`4 !1"h@,u@,F!1!`4 !1"@,d@,5Ȁ!1!`4 !1"@,S@,$Ԁ!1!`4 !1#@,B@,耤!1!`4 !1#@,1@,!6!` !6"@, @+܀ !` %2@,  @+ݔ䀒 !` %20@+ @+ʔ#255#254#253#252#251#250#249#248#247#246#245#244#243#242#241#240#239#238#237#236#235#234#233#232#231#230#229#228#227#226#225#224#223#222#221#220#219#218#217#216#215#214#213#212#211#210#209#208#207#206#205#204#203#202#201#200#199#198#197#196#195#194#193#192#191#189#188#187#186#185#184#183#182#181#180#179#178#177#176#175#174#173#172#171#170#169#168#167#166#165#164#163#162#161#160#159#158#157#156#155#154#153#152#151#150#149#148#147#146#145#144#143#142#141#140#139#138#137#136#135#134#133#132#131#130#129#128#127#126#125#124#123#122#121#120#119#118#117#116#115#114#113#112#111#110#109#108#107#106#105#104PIM#102#101#100#99#98Ethernet#96#95#94#93#92#91#80OSPF#88#87#86#85#84#83#82#81ISOIP#79#78#77#76#75#74#73#72#71#70#69#68#67#66#65#64#63#62#61destination optionno next headerICMP6#57#56#55#54#53#52AHESP#49#48#47#46#45fragmentrouting#42IP6#40#39#38#37#36#35#34#33#32#31#30TP#28#27#26#25#24#23IDP#21#20#19#18UDP#16#15#14#13#12#11#10#9#8#7TCP#5IP#3IGMPICMPhop by hop%s: %llu total packet%s received %llu with size smaller than minimum %llu with data size < data length %llu with bad options %llu with incorrect version number %llu fragment%s received %llu fragment%s dropped (dup or out of space) %llu fragment%s dropped after timeout %llu fragment%s that exceeded limit %llu packet%s reassembled ok %llu packet%s for this host %llu packet%s forwarded %llu packet%s not forwardable %llu redirect%s sent %llu packet%s sent from this host %llu packet%s sent with fabricated ip header %llu output packet%s dropped due to no bufs, etc. %llu output packet%s discarded due to no route %llu output datagram%s fragmented %llu fragment%s created %llu datagram%s that can't be fragmented %llu packet%s that violated scope rules %llu multicast packet%s which we don't join Input packet histogram: %s: %llu #%d: %llu Mbuf statistics: %llu one mbuf%s two or more mbuf: %s = %llu %llu one ext mbuf%s %llu two or more ext mbuf%s %llu packet%s whose headers are not continuous %llu tunneling packet%s that can't find gif %llu packet%s discarded due to too many headers %llu failure%s of source address selection source addresses on an outgoing I/F %llu node-local%s %llu link-local%s %llu site-local%s %llu global%s %llu addresses scope=%x source addresses on a non-outgoing I/F source addresses of same scope source addresses of a different scope deprecated source addresses %llu forward cache hit %llu forward cache miss  &x@(,9#(@(|x x!` x%90@(# @'@!` 9#P @' @!` 9#x @'Ӕ @!` 9# @'Ô @!` 9# @'  2!` %9@'ϐ @' 2!` %:@' @' 2!` %:0@' @'w 2!` %:X@' @'c䀒 2!` %:@' @'Ò 2!` %:@'k @'; 2!` %:@'W @'' 2!` %:@'C @'Ā 2!` %:@'/ @&Ԁ 2!` %:@' @& 2!` %:@@' @&ה܀ 2!` %:p@& @&Ô 2!` %:@&ߐ @&쀒 2!` %:@&ː @& 2!` %:@& @& 2!`  %:(@& @&s $ 2 !` ( %:X@& @&_(, (!` 0(%:@&{ @&K0  8hhh4 ;:9:0@@":@&4b S,!  @K 2 @&b"@&`װ :@&"40 0!`  0%:@&, @%  9:+: @h@%#( h@㒐@%c@  8< 28!` @8%:P@% @%ʔ@D 2@!` H@%:h@% @%HL 2H!` PH%:@%Ґ @%PT 2P!` XP%:@% @%X\ 2X!` `X%:@% @%z`d 2`!`  `%;(@% @%f  + ;;9; @ j;@%U`X "#` V-?P`t a 4M@%c ;@%2 B|  a 9 @%P@;@% /`(  a % @%<@;@%  `p܀  a  @%(@@$`  @$    + ;;9;7;@ @@ i;@$ېa "# U->O a 4L@$ ;@$ A  a 8 @$@;@$ .(  a $ @$@@$`p\ a 4@$ @$   @$x   ' ;;9;7;3;@ @@ h;@$aa0 "#  T,=N t  4K@$o ;@$> @|   7 @$\@@$,`. (  4%@$I @$  p܀    @$6@@$  @#`   ' ;;9;7;3;+; @ g;@#aX "" S+<M  4J@# @#Ő`@   7 @#@@# .(  4%@#А @#p\    @#@@#`  @#`   ' ;;9;7;3;-;+; @ g@#ma "" S+<Mt   I @#{@@#K @|  48@#i @#9.(   $ @#V@@#&`p܀  4@#C @#  @# ` 쀒@!` ;! @" @!`;! @" Warning: socket(AF_INET6)ip6 on %s: Warning: ioctl(SIOCGIFSTAT_IN6) %llu total input datagram%s %llu datagram%s with invalid header received %llu datagram%s exceeded MTU received %llu datagram%s with no route received %llu datagram%s with invalid dst received %llu truncated datagram%s received %llu datagram%s with unknown proto received %llu input datagram%s discarded %llu datagram%s delivered to an upper layer protocol %llu datagram%s forwarded to this interface %llu datagram%s sent from an upper layer protocol %llu total discarded output datagram%s %llu output datagram%s failed on fragment %llu output datagram%s succeeded on fragment %llu incoming datagram%s fragmented %llu datagram%s reassembled %llu datagram%s failed on reassembling %llu multicast datagram%s received %llu multicast datagram%s sent x  @6 @@w"0@@@!"0HaS@K @@d"0쀒 !` %@@! @!͔ 2!` %@@! @! 2!` %@(@!Ր @! 2!` %@P@! @! 2!` %@@! @!} 2!` %@@! @!i 2!`  %@@! @!U $ 2 !` ( %A@!q @!A(, 2(!` 0(%A0@!] @!-04 20!` 80%Ah@!I @!8< 28!` @8%A@!5 @!@D 2@!` H@%A@!! @ HL 2H!` PH%:@!  @ ݔPT 2P!` XP%A@  @ ɔX\ 2X!` `X%A0@  @ `d 2`!` h`%A`@ ѐ @ hl 2h!` ph%A@  @ pt 2p!` xp%A@  @ yx| 2x!` x%A@  @ e 2!` %A@  @ Q@1node information replynode information requestrouter renumberingredirectneighbor advertisementneighbor solicitationrouter advertisementrouter solicitationmulticast listener donemulticast listener reportmulticast listener queryecho replyecho#103#97#89#60#59#58#51#50#44#43#41#29#22#17#6parameter problemtime exceedpacket too bigunreach#0 %llu call%s to icmp6_error %llu error%s not generated because old message was icmp6 or so %llu error%s not generated because of rate limitation Output packet histogram: %llu message%s with bad code fields %llu message%s < minimum length %llu bad checksum%s %llu message%s with bad length Histogram of error messages to be generated: %llu no route %llu administratively prohibited %llu beyond scope %llu address unreachable %llu port unreachable %llu packet too big %llu time exceed transit %llu time exceed reassembly %llu erroneous header field %llu unrecognized next header %llu unrecognized option %llu redirect %llu unknown %llu message response%s generated %llu message%s with too many ND options %llu message%s with bad ND options %llu bad neighbor solicitation message%s %llu bad neighbor advertisement message%s %llu bad router solicitation message%s %llu bad router advertisement message%s %llu bad redirect message%s %llu path MTU change%s h ?#@9#(@` !`4?!C"@ @?#  2!` ?!C#@ @t?# 2!` T!C#H@ @]T?#aȐ ?cx@?"@#?"#?#b@?"@"?""?#b@?"@"?""?#c P@?"@"Ȑ?""ܐИ?#bؘؒ@?"@"Ԓ?""А?#b̒@?"@"  PX`hp"3C#: @ ",@c ,@bؤ ?# 2!` ?!C#@ @ϔ?#$ 2 !` ? !C#@ @?#,( 2(!` ?(!C#@ѐ @?#40 20!` T0!D @ @T!Ȱ  +:': @@ ",@xb ,@qؤ` D@i 0?c  H  !` ? D ` @S ?#`P  !` ? @D x @= ?#`X   !` ? D  @' ?#```  !` ? @D  @ ?#?# `h  !` ? @D ؒ @ ?#?# `p  !` ? @D  @ݔ ?#?# `x  !` ? @D! @Ô ?#?" `  !` ? @D!0 @ ?#?" `  !` ? @D!P @ ?#?" `  !` ? @D!p @u ?#?" `  !` ? @D! @[ ?#?" `  !` ? @D! @A ?#?" `  !` ? @D!В @' ?#<8 28!` ?8!D!@@ @?#?#  `@  !`? @!D"@" @?#?" `  !`? @!D"8@ @Ԕ?#?"ܐ `  !`? @!D"`@ @?#?"ؐ `  !`? @!D"@Ȑ @?#?"Ԑ `  !#!/bin/sh # $OpenBSD: install.sh,v 1.95 2002/04/12 03:24:02 millert Exp $ # $NetBSD: install.sh,v 1.5.2.8 1996/08/27 18:15:05 gwr Exp $ # # Copyright (c) 1997-2002 Todd Miller, Theo de Raadt, Ken Westerback # All rights reserved. # # Redistribution and use in source and binary forms, with or without # modification, are permitted provided that the following conditions # are met: # 1. Redistributions of source code must retain the above copyright # notice, this list of conditions and the following disclaimer. # 2. Redistributions in binary form must reproduce the above copyright # notice, this list of conditions and the following disclaimer in the # documentation and/or other materials provided with the distribution. # 3. All advertising materials mentioning features or use of this software # must display the following acknowledgement: # This product includes software developed by Todd Miller and # Theo de Raadt # 4. The name of the author may not be used to endorse or promote products # derived from this software without specific prior written permission. # # THIS SOFTWARE IS PROVIDED BY THE AUTHOR ``AS IS'' AND ANY EXPRESS OR # IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES # OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE ARE DISCLAIMED. # IN NO EVENT SHALL THE AUTHOR BE LIABLE FOR ANY DIRECT, INDIRECT, # INCIDENTAL, SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT # NOT LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, # DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY # THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT # (INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE OF # THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. # # Copyright (c) 1996 The NetBSD Foundation, Inc. # All rights reserved. # # This code is derived from software contributed to The NetBSD Foundation # by Jason R. Thorpe. # # Redistribution and use in source and binary forms, with or without # modification, are permitted provided that the following conditions # are met: # 1. Redistributions of source code must retain the above copyright # notice, this list of conditions and the following disclaimer. # 2. Redistributions in binary form must reproduce the above copyright # notice, this list of conditions and the following disclaimer in the # documentation and/or other materials provided with the distribution. # 3. All advertising materials mentioning features or use of this software # must display the following acknowledgement: # This product includes software developed by the NetBSD # Foundation, Inc. and its contributors. # 4. Neither the name of The NetBSD Foundation nor the names of its # contributors may be used to endorse or promote products derived # from this software without specific prior written permission. # # THIS SOFTWARE IS PROVIDED BY THE NETBSD FOUNDATION, INC. AND CONTRIBUTORS # ``AS IS'' AND ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED # TO, THE IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR # PURPOSE ARE DISCLAIMED. IN NO EVENT SHALL THE REGENTS OR CONTRIBUTORS BE # LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, SPECIAL, EXEMPLARY, OR # CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT LIMITED TO, PROCUREMENT OF # SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, DATA, OR PROFITS; OR BUSINESS # INTERRUPTION) HOWEVER CAUSED AND ON ANY THEORY OF LIABILITY, WHETHER IN # CONTRACT, STRICT LIABILITY, OR TORT (INCLUDING NEGLIGENCE OR OTHERWISE) # ARISING IN ANY WAY OUT OF THE USE OF THIS SOFTWARE, EVEN IF ADVISED OF THE # POSSIBILITY OF SUCH DAMAGE. # # OpenBSD installation script. # In a perfect world, this would be a nice C program, with a reasonable # user interface. # A list of devices holding filesystems and the associated mount points # is kept in the file named FILESYSTEMS. FILESYSTEMS=/tmp/filesystems # The Fully Qualified Domain Name FQDN= # install.sub needs to know the MODE MODE=install # include common subroutines and initialization code . install.sub if [ ! -f /etc/fstab ]; then # Install the shadowed disktab file; lets us write to it for temporary # purposes without mounting the miniroot read-write. if [ -f /etc/disktab.shadow ]; then cp /etc/disktab.shadow /tmp/disktab.shadow fi while : ; do if [ "X${ROOTDISK}" = "X" ]; then while [ "X${ROOTDISK}" = "X" ]; do getrootdisk done DISK=$ROOTDISK else DISK= while [ "X${DISK}" = "X" ]; do getanotherdisk done if [ "${DISK}" = "done" ]; then break fi fi # Deal with disklabels, including editing the root disklabel # and labeling additional disks. This is machine-dependent since # some platforms may not be able to provide this functionality. md_prep_disklabel ${DISK} # Assume partition 'a' of $ROOTDISK is for the root filesystem. # Loop and get the rest. # XXX ASSUMES THAT THE USER DOESN'T PROVIDE BOGUS INPUT. cat << __EOT You will now have the opportunity to enter filesystem information for ${DISK}. You will be prompted for the mount point (full path, including the prepending '/' character) for each BSD partition on ${DISK}. Enter "none" to skip a partition or "done" when you are finished. __EOT if [ "${DISK}" = "${ROOTDISK}" ]; then cat << __EOT The following partitions will be used for the root filesystem and swap: ${ROOTDISK}a / ${ROOTDISK}b swap __EOT echo "${ROOTDISK}a /" > ${FILESYSTEMS} fi # XXX - allow the user to name mount points on disks other than ROOTDISK # also allow a way to enter non-BSD partitions (but don't newfs!) # Get the list of BSD partitions and store sizes _npartitions=0 for _p in `disklabel ${DISK} 2>&1 | grep '^ *[a-p]:.*BSD' | sed 's/^ *\([a-p]\): *\([0-9][0-9]*\) .*/\1\2/'`; do _pp=`firstchar ${_p}` if [ "${DISK}" = "${ROOTDISK}" -a "$_pp" = "a" ]; then continue fi _ps=`echo ${_p} | sed 's/^.//'` _partitions[${_npartitions}]=${_pp} _psizes[${_npartitions}]=${_ps} # If the user assigned a mount point, use it. if [ -f /tmp/fstab.${DISK} ]; then _mount_points[${_npartitions}]=`sed -n "s:^/dev/$DISK$_pp[ ]*\([^ ]*\).*:\1:p" < /tmp/fstab.${DISK}` fi _npartitions=$(( ${_npartitions} + 1 )) done # Now prompt the user for the mount points. Loop until "done" echo _i=0 resp=X while [ $_npartitions -gt 0 -a X${resp} != X"done" ]; do _pp=${_partitions[${_i}]} _ps=$(( ${_psizes[${_i}]} / 2 )) _mp=${_mount_points[${_i}]} # Get the mount point from the user while : ; do echo -n "Mount point for ${DISK}${_pp} (size=${_ps}k) [$_mp, RET, none, or done]? " getresp "$_mp" case $resp in /*) _mount_points[${_i}]=$resp break ;; done|"")break ;; none) _mount_points[${_i}]= break ;; *) echo "mount point must be an absolute path!" break ;; esac done _i=$(( ${_i} + 1 )) if [ $_i -ge $_npartitions ]; then _i=0 fi done # Now write it out, sorted by mount point for _mp in `bsort ${_mount_points[*]}`; do _i=0 while [ $_i -lt $_npartitions ] ; do if [ $_mp = "${_mount_points[${_i}]}" ]; then echo "${DISK}${_partitions[${_i}]} ${_mount_points[${_i}]}" >> ${FILESYSTEMS} _mount_points[${_i}]= break fi _i=$(( ${_i} + 1 )) done done rm -f /tmp/fstab.${DISK} done cat << __EOT You have configured the following devices and mount points: $(<${FILESYSTEMS}) ============================================================ The next step will overwrite any existing data on: __EOT ( echo -n " " while read _device_name _junk; do echo -n "${_device_name} " done echo ) < ${FILESYSTEMS} echo -n "\nAre you really sure that you're ready to proceed? [n] " getresp n case $resp in y*|Y*) ;; *) echo "ok, try again later..." exit ;; esac # Loop though the file, place filesystems on each device. echo "Creating filesystems..." ( while read _device_name _junk; do newfs -q /dev/r${_device_name} done ) < ${FILESYSTEMS} else # Get the root device ROOTDISK=`df /mnt | sed -e '/^\//!d' -e 's (08@HPX`hpx (08@HPX`hpx (08@HPX`hpxhpx (08@HPX`hpx (08@HPX`hpx (08@HPX`hpx@HPX`hpx`? @!D"@ @z?#?"А `  !`? @!D"@ @\?#?"̐ `  !`? @!D# @n @>?#?" `  !`  @!D#@@Q @!icmp6 on %s: Warning: ioctl(SIOCGIFSTAT_ICMP6) %llu total input message%s %llu total input error message%s %llu input destination unreachable error%s %llu input administratively prohibited error%s %llu input time exceeded error%s %llu input parameter problem error%s %llu input packet too big error%s %llu input echo request%s %llu input echo reply%s %llu input router solicitation%s %llu input router advertisement%s %llu input neighbor solicitation%s %llu input neighbor advertisement%s %llu input redirect%s %llu input MLD query%s %llu input MLD report%s %llu input MLD done%s %llu total output message%s %llu total output error message%s %llu output destination unreachable error%s %llu output administratively prohibited error%s %llu output time exceeded error%s %llu output parameter problem error%s %llu output packet too big error%s %llu output echo request%s %llu output echo reply%s %llu output router solicitation%s %llu output router advertisement%s %llu output neighbor solicitation%s %llu output neighbor advertisement%s %llu output redirect%s %llu output MLD query%s %llu output MLD report%s %llu output MLD done%s x  @ @@I"0@H@!0HaT@ H@6!0쀒 !` %H@ϐ @ 2!` %H@ @ 2!` %H(@ @w 2!` %HX@ @c 2!` %H@ @O 2!` %H@k @; 2!`  %H@W @' $ 2 !` ( %H@C @(, 2(!` 0(%H(@/ @04 20!` 80%HH@ @8< 28!` @8%Hp@ @ה@D 2@!` H@%H@ @ÔHL 2H!` PH%H@ߐ @PT 2P!` XP%H@ː @X\ 2X!` `X%I@ @`d 2`!` h`%I @ @shl 2h!` ph%I@@ @_pt 2p!` xp%IX@{ @Kx| 2x!` x%Ix@g @7 2!` %I@S @# 2!` %I@? @ 2!` %I@+ @ 2!` %I0@ @ 2!` %IX@ @Ӕ 2!` %I@ @ 2!` %I@ې @ 2!` %I@ǐ @Ā 2!` %I@ @̀ 2!` %I@ @oԀ 2!` %I8@ @[܀ 2!` %I`@w @G䀒 2!` %I@c @3쀒 2!` %I@O @ 2!` %I@; @ @ %llu message%s received %llu message%s received with too few bytes %llu message%s received with bad checksum %llu message%s received with bad version %llu register%s received %llu bad register%s received %llu register%s sent ` @̔ 89#(@ !` %L@֐ @̀ 2!` %L(@ @Ԁ 2!` %LX@ @~܀ 2!` %L@ @j䀒 2!` %L@ @V쀒 2!` %L@r @B !` %L@_ @/%.*s.tcp6tcpudp6udp%.8s*%d %-*.*sH"l`   a`  @i@1:!M@b@*!M@Z!p@ @א"@``Max@  MMa@ M@fM`.`M!aaM!@ɐblMa@•2bl   !`  @ܐ@אM!@ ?pUaȀ %@ > "aȦ# @l\! 2 , @p . @R`@, @ %         @i  "@K . c @` ",@ `  `   ` `!Ma!" @H!2"     ?  ???  ?//''''' /'/ !#\ؐؔ! @k M#7!" @!" $OpenBSD: ipx.c,v 1.10 2002/02/16 21:27:50 millert Exp $dropresponduseroutputinputspx??? Active Internetwork Packet Exchange connections (including servers)%-*.*s %-5.5s %-6.6s %-6.6s %-*.*s %-*.*s %s PCBProtoRecv-QSend-QLocal AddressForeign Address(state)%-5.5s %-6.6s %-6.6s %-22.22s %-22.22s %s %*p %-5.5s %6ld %6ld %-22.22s %-22.22s %d %sX 'HNbP@Ґ`?@ N #`'ܨ 7N5N!`     ܲ  `@  0H@z hU!!`D'N@b"``N@\"!`` ?"`!`* $!`@c "l`N"NNbNN#\#h#t"b#`#d#l#p#x  @2%aNNN "bN#\@$%al N 0cP@ ` LN tH@#X@N@ p@?N@cH ` SN@# !`*`LN@#!`` ?"`!`* $!`@c ܀@  #ܬ@ \ @QN@֐"X%s: %ld %s%s%s -- %s connection dropped due to no new sockets x terminated due to our end dying dropped due to inability to connect incompleted due to mismatched id's dropped due to mismatched id'spacket dropped out of sequence duplicating the highest packet refused as exceeding allocation initiated accepted established droppedembryonic connection closed (includes drops) where we tried to get rtttime we got rttdelayed ack sent dropped in rxmt timeoutretransmit timeoutpersist timeoutkeepalive timeoutkeepalive probe dropped in keepalivetotal packetdata packetdata byte retransmittedack-only packetwindow probe sent with URG onlywindow update-only packetcontrol (SYN|FIN|RST) packetrequest to send a non-existant packet received received in sequencebyte received with ccksum errs received with bad offset received too shortduplicate-only packetduplicate-only byte with some duplicate datadup. byte in part-dup. packetout-of-order packetout-of-order byte with data after window rcvd after window rcvd after 'close'rcvd window probe packetrcvd duplicate ackrcvd ack for unsent datarcvd ack packet acked by rcvd acksrcvd window update packet  @o O"@]W* !O#O"آb@OO#@Kc W4 !O#O"آb@mOO#(@9c W* !O#O"آb@[OO#P@'c W, !O#O"آb@IOO#P@c W. !O#O"آb@7OO#x@c W0 !O#O"آb@%OO#@c W2 !O#O"آc@OO#@ߚc W8 !O#O"آc@OO#@͚c W6 !O#O"آc@PO @c < !O#O"آb@ݐPO 0@c @ !O#O"آb@ːPO @@c D !O#O"آb@PO P@c H !O#O"آb@PO `@sc L !O#P"آ`p@PO `@ac P !O#O"آb@PO @Oc T !O#O"آc@qPO @=c X !O#P"آ`@_PO @+c \ !O#P"آ`@MPO @c ` !O#O"آb@;PO @c d !O#P"آa@)PO!0@c h !O#P"آa8@PO!0@c l !O#P"آaH@PO!0@њc p !O#P"آa`@PO @c t !O#O"آb@PO!p@c x !O#P"آa@ϐPO @c | !O#P"آa@PO @c  !O#P"آa@PO @wc  !O#P"آa@PO!@ec  !O#P"آa@PO!@Sc  !O#P"آa@uPO @Ac  !O#P"آa@cPO @/c  !O#O"آc@QPO!@c  !O#P"آb@?PO @ c  !O#P"آb @-PO @c  !O#P"آb@@PO"H@c  !O#P"آa@ PO"h@՚c  !O#O"آc@PO"x@Úc  !O#P"آb@PO"x@c  !O#O"آc@ӐPO"@c  !O#O"آc@PO"@c  !O#O"آc@PO"@{c  !O#P"آb@PO"h@ic  !O#P"آc@PO"h@Wc Ā !O#O"آc@yPO# @Ec Ȁ !O#P"آc@@gPO#P@3c ̀ !O#P"آch@UPO"h@!c Ѐ !O#P"آc@CPO"h@c Ԁ !O#O"آc@1PO#@c ؀ !O#P"آb@PO#@c ܀ !O#O"آc@ PO#@ٚc  !O#P"آc@PO!0@ǚc 䀦 !O#Q"آ`@PO!0@c 耦 !O#Q"آ`@אQO (@c 쀦 !O#Q"آ`@@ŐPO!0@c  !O#P"آb@QO P@c  !O#Q"آ`h@PO!0@mc  %ld %s%s%s smaller than a header smaller than advertised with bad checksumsh 8@[ ,O"@IԀ !U#O xc@kU@9 Ѐ !U#O xc@[U@) ̀ !U#O xc@KU@ 㿘Ua*`  *` *` *` *` *`  *`  *`  *`  *`  *` @#>*`$OpenBSD: iso.c,v 1.9 2002/02/16 21:27:50 millert Exp $%s: %d esh sent, %d esh received %d ish sent, %d ish received %d rd sent, %d rd received %d pdus not sent due to insufficient memory %d pdus received with bad checksum %d pdus received with bad version number %d pdus received with bad type field %d short pdus received 㿀 -@   (U@ "xU@ "U@ "U@ "U@ ~"U@ z#U@ v#8U@ r#hU@ n#%s: %d total packets sent %d total fragments sent %d total packets received %d with fixed part of header too small %d with header length not reasonable %d incorrect checksum%s %d with unreasonable address lengths %d with forgotten segmentation information %d with an incorrect protocol identifier %d with an incorrect version %d dropped because the ttl has expired %d clnp cache misses %d clnp congestion experience bits set %d clnp congestion experience bits received 㾀 D@ ! ? V@ Ր pV@ ѐ V@ ͐ V@ ɐ V@ Ő!!V!(@ @ V@ !HV@ !pV@ !V@ !V@ !4V@ " 8V@ "8V<@ "h%s: %u incomplete header%s %u bad data length field%s %u bad checksum%s 㿀 "@   !V#@ @ s!V#@ @ j!V#@ @ a%s control block: symbol not in namelist tpprev %p next %p isop_prev %p isop_next %p??? 耦 WW @ <0G`@q 2 H@S0=W @ +06@ 4 0!"@攔 "@&'"@  `ߔ ` @ @^ `` ?"``* "`@[ Active ISO net connections (including servers)%-*.*s %-5.5s %-6.6s %-6.6s %-*.*s %-*.*s %s PCBProtoRecv-QSend-QLocal AddressForeign Address(state)%-5.5s %-6.6s %-6.6s %-22.22s %-22.22s %s %*p %-5.5s %6ld %6ld () *.* xU"`N!W@ "Xa W@ "x``?"`` * "`@[2 "l`WWWW WWWW#\#h#p#t#x""Țb#`#d#l@ l $bWWWWWWW#\#bȔЖؘ"@ Zb$b"l  !  Wc8@ L   tWW L#@@ D`؀` a  Wa@DXW@ 6#``"` lW@ +#h`!`l#(@嘔 #( #(@ * #(@֒ ` `΀  W`@XW@ #`0"` W@ #h0! ` @@o  @  @@   @@ undefined tpcb state: %p %d %-12.12s㿈 @ *`@⤐ h@ *` ^W -X+)'X`N  @ ʔ! `@ h!`2    8 6 5 `@   `  @4 "@     `*`X@ "@ `` ?"``* "`@Z  * @*%8lx tpip㾰` @ pa  H@' "l`"Y p@ N``tW`L#@Y@ E`x!W NHL8TP not configured 㿘 Y@ ,!@0 U@ ("x!#!@ 0@u %*sReceiving: %*s%ld variable parameter%s ignored %*s%ld invalid parameter code%s %*s%ld invalid parameter value%s %*s%ld invalid dutype%s %*s%ld negotiation failure%s %*s%ld invalid destination reference%s %*s%ld invalid suffix parameter%s %*s%ld invalid length %*s%ld invalid checksum%s %*s%ld DT%s out of order %*s%ld DT%s not in window %*s%ld duplicate DT%s %*s%ld XPD%s not in window %*s%ld XPD%s w/o credit to stash %*s%ld time%s local credit reneged %*s%ld concatenated TPDU%s %*sSending: %*s%ld XPD mark%s discarded %*sXPD stopped data flow %ld time%s %*s%ld time%s foreign window closed %*sMiscellaneous: %*s%ld small mbuf%s %*s%ld cluster%s %*s%ld source quench %*s%ld dec bit%s %*sM:L ( M mbuf chains of length L) %*s%ld: over 16 %*s%ld: %d %ld: %d %*s%ld EOT rcvd %*s%ld EOT sent %*s%ld EOT indication%s %*sConnections: %*s%ld connection%s used extended format %*s%ld connection%s allowed transport expedited data %*s%ld connection%s turned off checksumming %*s%ld connection%s dropped due to retrans limit %*s%ld tp 4 connection%s %*s%ld tp 0 connection%s LOCAL, PDN LOCAL,~PDN~LOCAL,~PDN~LOCAL, PDN %*sRound trip times, listed in ticks: %*s%11.11s %12.12s | %12.12s | %s CategorySmoothed avgDeviationDeviation/Avg %*s%11.11s: %-11d | %-11d | %-11d | %-11d %*sTpdus RECVD [%ld valid, %3.6f %% of total (%ld); %ld dropped] %*sDT %6ld AK %6ld DR %4ld CR %4ld %*sXPD %6ld XAK %6ld DC %4ld CC %4ld ER %4ld %*sTpdus SENT [%ld total, %ld dropped] %*sRetransmissions: %*sCR %6ld CC %6ld DR %6ld %*sDT %6ld (%5.2f%%) %*sXPD %6ld (%5.2f%%) %*sE Timers: [%6ld ticks] %*s%6ld timer%s set %6ld timer%s expired %6ld timer%s cancelled %*sC Timers: [%6ld ticks] %*s%6ld inactive timer%s cancelled %*sPathological debugging activity: %*s%6ld CC%s sent to zero dref %*s%6ld random DT%s dropped %*s%6ld illegally large XPD TPDU%s %*s%6ld faked reneging of cdt %*sACK reasons: %*s%6ld not acked immediately %*s%6ld strategy==each %*s%6ld strategy==fullwindow %*s%6ld duplicate DT %*s%6ld EOTSDU %*s%6ld reordered DT %*s%6ld user rcvd %*s%6ld fcc reqd B㿀%'Y`Ya@@!Y!@Ð@`!Y!@@ݐ` !Y"@@ѐ`!Y"@@@Ő`!Y"`@@`!Y"@@`$!Y"@{@` Ybؖ@`!Y"@h@`H!Y#@\@`L!Y#0@P@v`X!Y#P@D@j`P!Y#h@8@^`T!Y#@,@R``!Y#@ @Fa!Y#@@:Yc@4`D!Z @@(`@!Z (@@`\!Z P@@Z`x@ a !Z @ؐ@a$!Z @̐@aZ`@a!Z @@ߐZ`@ِZa(a@Ҕa( %Z/Z, @, @ , #`#\`0@a  $, al`aZaH@atZa`@ap!Z@|!x@Za@`,!Z@j!@`0!Z@^!@`4!Z@R"@w`!Z@F"H@ka|!Z@:"@_ax!Z@."@SZc@MZcpZ##\#`ZZZc(#Pc`@=Uaa"  ` a#d#\#`@+ `dZ`h# ``a' U"B[cl'􀢠"U"Bą"?  `<#`#d#\@`#[```Ħa`̢`#\#`@`![` 8`Ȗ`#\`#`#d@ܐ`l[`8`x@Ԑ````#\#`@ɐ````#\`#`#d@[`@`t[`|``x#\@`[` `' UB[cl' "U"Bą"?  @#\`[`a`a' UbB[cl'􀢠"UBą"?  @\#\`Ԣ`a[a@S`@#'[`@8`@+[`ܔ#h`ؚ#``#\#d@;`[a@4`@a`@1[`@!`#h`#``#\#d@`)[@@[aȖ@ a"@ڐ@a-[@ϐ@a8@Đ@a[b`@[b@ݐa[b@֐a[b@ϐa[bؖ@Ȑa[b@a[c@a[c(@a[c@@[aĐcX@{}[]<>㿘 _@J   2    2   "   W`  @7X 2   "   _ ` @ @&   _ `   @ @ @``?"``` * "`@S %s㿘@ $ @ U"  .@*`  :  ** *@ *@_( "@ *@*$OpenBSD: main.c,v 1.30 2002/02/16 21:27:50 millert Exp $_ipcompstat_mclpool_mbpool_mif6table_mf6ctable_mrt6stat_ip6_mrtproto_pim6stat_ipsec6stat_ipsecstat_icmp6stat_ip6stat_etheripstat_ddpcb_ddpstat_ipipstat_espstat_ahstat_ipx_errstat_spx_istat_ipxstat_ipxcbtable_viftable_mfchash_mfchashtbl_mrtstat_ip_mrtproto_igmpstat_file_nfile_cltpstat_cltb_rt_tables_nimp_esis_stat_tp_stat_tp_refinfo_tp_inpcb_clnp_stat_ns_errstat_spp_istat_idpstat_nspcb_unixsw_rtstat_icmpstat_imp_softc_ifnet_udpstat_udbtable_tcpstat_tcbtable_ipstat_mbstatipcompetheripipencapespahigmpicmpipudptcppim6icmp6ip6spxipxns_errsppidpesisclnpcltptpddpAabdf:gI:ilM:mN:np:qrstuvw:inetinet6localunixnsisoencapatalk%s: %s: unknown address family %s: %s: unknown or uninstrumented protocol %s: kvm_open: %s %s: %s: no namelist %s: no namelist %s: no stats routine 㷘@'D   ""h# ' ;975-1` 8c* @€ "bl " "b@  "8`b@ ` $hb@ ` $hb@ {`b@| u`b@v ` z$hb@m( ` q$hb@d0 ` h$hb@[8 ` _$hb@R@ P V$h <`b!@dcH@Y   I"aHb $C"| @$ <"c:b 6"4b 1'b@@Eb   P <`b!@9ch@. "ad '!h "xa "a &  $h  &`@X5b %l$@wD@"耢?C?* @@c\ @ `" @@X %l@Z $`@  ``   @@@@!  @  "P <`!c@ϖ@Đ @@@@ `U@    2  P <`!c@0 <`!@c@ڜ `  "x@"l@ڒ d     * @*`  0` @/#@| @a @  "al P@n bx  !`@S t0@!@_  H 4!`h  !X@{!L"h  UH@s<0  !|!L!d@!p"h  U`<@iT@( h  % @&` @Z 0!8  @ 2     @@&h V@&Uh   hVa@  2 h   hVH@~  2 h   hV"x@n  2 h   hVb@^  2 h   2hU"@:`h   Vc@B  2 @٣ d<Tt ,D\h㿘!` U * b* `@  * b* `@    "h` %s: %s 㿘!  @GP  <# a!c@ڠ"H@4?s c_0es c_0㿘Vc( c(@      2 㿘  @%B@@%( 0 @ϐ   2@%> 2`@%+ usage: %s [-Aan] [-f address_family] [-M core] [-N system] %s [-gimnrs] [-f address_family] [-M core] [-N system] %s [-n] [-I interface] [-M core] [-N system] [-w wait] %s [-M core] [-N system] [-p protocol] 㿘#P!!`<d`@`<d`H@`<d`@`<d@`@ $OpenBSD: mbuf.c,v 1.12 2002/02/23 01:12:54 art Exp $socket optionssocket names and addressesfragment reassembly queue headerspacket headersancillary dataoob datadata%s: unexpected change to mbstat; check source %s: mbstat: symbol not in namelist %u mbuf%s in use: %u mbuf%s allocated to %s %u mbuf%s allocated to %lu/%lu mapped pages in use %u Kbytes allocated to network (%d%% in use) %lu requests for memory denied %lu requests for memory delayed %lu calls to protocol drain routines 㿘@Vc!  P <d!@b(0  P <d!@ݒbX0!"  c 䀢  a| 䀢 V#L` ` ) @`* ` !d"@S#L` ! bH 1d@*` *& @* h`@8"`` 2@㌐  @ %"H! "H%d,``㌑,`@  H@㌢`@&,` %d $@ 8@ۯ 4@4 4@ۦ@۠"   @ۚ" @,`* * @+ d`#c@ߓ:`  d@ڐ#0 d@֐#Pd @Ґ#x%lu%c㿘  # k2  m21 e@? ip_mrtproto: symbol not in namelist no multicast routing compiled into this system multicast routing protocol %u, unknown mfchashtbl: symbol not in namelist mfchash: symbol not in namelist viftable: symbol not in namelist Virtual Interface Table %s%sVif Thresh Limit Local-Address Remote-Address Pkt_in Pkt_out %3u %3u %5u %-15.15s %-15.15s %6lu %7lu Virtual Interface Table is empty Multicast Forwarding Cache %s%sHash Origin Mcastgroup Traffic In-Vif Out-Vifs/Forw-ttl %3u %-15.15s %-15.15s %7s %3u %u/%u Multicast Forwarding Cache is empty Total no. of entries in cache: %d 㶰 'He@#H0ג$ $``e@#p0e@#0H e@#0e@ڐ#0f@Ԑ 0"@x' ""@ؔ(    ;f9f/f+f)f  #.2  @`@`   @H @ f` @; f  @ $*`2   ְ D2Hf@ H    `R N  .`@ `?`9f/f-f+f)f2!@@fp (o P0@ @Za4@ \8@O! @:#f.2  "@BaȒ*`2  @:a(`'@ ff@*!0"@&@$a""@mrtstat: symbol not in namelist multicast routing: %ld datagram%s with no route for origin %ld upcall%s made to mrouted %ld datagram%s with malformed tunnel options %ld datagram%s with no room for tunnel options %ld datagram%s arrived on wrong interface %ld datagram%s dropped due to upcall Q overflow %ld datagram%s dropped due to upcall socket overflow %ld datagram%s cleaned up by the cache %ld datagram%s dropped selectively by ratelimiter %ld datagram%s dropped - bucket Q overflow %ld datagram%s dropped - larger than bkt size X e@#H0 ``e@u#p0ve@p#0q`g@i!0js 4g@b!!g!@Y!g"@P!g"8v@G!g"hm@>!g"d@5!g"[@,!g#R@#!g#@I@!g#p@@!g#7@!g#.@$OpenBSD: ns.c,v 1.7 2002/02/16 21:27:50 millert Exp $dropresponduseroutputinputspp??? Active NS connections (including servers)%-8.8s PCB%-5.5s %-6.6s %-6.6s %-18.18s %-18.18s %s %-5.5s %-6.6s %-6.6s %-22.22s %-22.22s %s ProtoRecv-QSend-QLocal AddressForeign Address(state)%8lx %-5.5s %6ld %6ld %-22.22s %-22.22s %d %s8 Ƹh@ƒb`?! T"D@ T"D@7 ;ha         `r  (` ㈐i hV2~V#%`;!h@M"a`h@G"`` ?"``* $`@Iߐ "l`hhb@/"l h"h#h#x#\ h@hHh#PhcXh@h%"l " h#@  th L@#@C@c@>h@c ` Sh@# `*`Lh@#Ȓ`` ?"``* $`@I D  T @Zh@͐"%s: %ld %s%s%s -- %s connection dropped due to no new sockets x terminated due to our end dying dropped due to inability to connect incompleted due to mismatched id's dropped due to mismatched id'spacket dropped out of sequence duplicating the highest packet refused as exceeding allocation initiated accepted established droppedembryonic connection closed (includes drops) where we tried to get rtttime we got rttdelayed ack sent dropped in rxmt timeoutretransmit timeoutpersist timeoutkeepalive timeoutkeepalive probe dropped in keepalivetotal packetdata packetdata byte retransmittedack-only packetwindow probe sent with URG onlywindow update-only packetcontrol (SYN|FIN|RST) packetrequest to send a non-existant packet received received in sequencebyte received with ccksum errs received with bad offset received too shortduplicate-only packetduplicate-only byte with some duplicate datadup. byte in part-dup. packetout-of-order packetout-of-order byte with data after window rcvd after window rcvd after 'close'rcvd window probe packetrcvd duplicate ackrcvd ack for unsent datarcvd ack packet acked by rcvd acksrcvd window update packet  e i"@SW* !i#i#cuii#(@AcHW4 !i#i#ccii#P@/cHW* !i#i#cQii#x@cHW, !i#i#c?ii#x@ cHW. !i#i#c-ii#@cHW0 !i#i#cii#@cHW2 !i#i#c ii#@՚cHW8 !i#i#cji @ÚcHW6 !i#i#cji 0@cH< !i#i#cӐji X@cH@ !i#i#cji h@cHD !i#i#cji x@{cHH !i#i#cji @icHL !i#j#`ji @WcHP !i#i#cyji @EcHT !i#i#cgji @3cHX !i#j#`Uji @!cH\ !i#j#aCji!@cH` !i#i#c1ji! @cHd !i#j#a@ji!X@cHh !i#j#a` ji!X@ٚcHl !i#j#apji!X@ǚcHp !i#j#aji!@cHt !i#i#cאji!@cHx !i#j#aŐji!@cH| !i#j#aji!@cH !i#j#aji!@mcH !i#j#aji!@[cH !i#j#a}ji!@IcH !i#j#akji!@7cH !i#j#bYji!@%cH !i#i#cGji"@cH !i#j#b(5ji!@cH !i#j#bH#ji!@cH !i#j#bhji"p@ݚcH !i#j#aji"@˚cH !i#i#cji"@cH !i#j#bېji"@cH !i#i#cɐji"@cH !i#i#cji"@cH !i#i#cji#@qcH !i#j#cji"@_cH !i#j#c0ji"@McHĀ !i#i#coji#H@;cHȀ !i#j#ch]ji#x@)cH̀ !i#j#cKji"@cHЀ !i#j#c9ji"@cHԀ !i#i#c'ji#@cH؀ !i#j#bji#@cH܀ !i#i#cji#@ϚcH !i#k#`ji!X@cH䀦 !i#k#`(ߐji!X@cH耦 !i#k#`@͐ki P@cH쀦 !i#k#`hji!X@cH !i#j#bki x@ucH !i#k#`ji!X@ccH %d %s%s%s smaller than a header smaller than advertised with bad checksums㿀 8Q i"@?耦 !o#i cao@/ 䀦 !o#i cQo@  !o#i cAo@  too large to be forwarded forwarded too many times while gatewayed Refused due to lack of space at DestinationPacket at SocketNo ListenerBad Checksum at DestinationUnspecified ErrorNS error statistics: call to ns_errorerror ignored due to insufficient addressingerror request in response to error packetserror packet received incomplete received of unknown typeOutput Error Histogram: Input Error Histogram: 㾰   o@" !o#o bo@t" !o#o co@d# !o#o c8o@T#Hp !o#o chvo@D#xl !o#o chfo@4# Ъ)o,` ",`@&# ,``@+`,`  %o,`@ ",`@Ц ,``@`,`in transitat destinationUnknown XNS error code 0%ox V*` * c ` 2``p"p"p(@\   !o @ǘ㿘W`2`  2` 2` 2` 2`  @C2` $OpenBSD: route.c,v 1.45 2002/02/16 21:27:50 millert Exp $Routing tables rt_tables: symbol not in namelist Netmasks: p@#bl   W t` @y  p@{#08`Đ   !'p%W .  &w t "hbl " "h 2 @\@G  2 @1 $p@0@@4  ֑. InternetInternet6XNSIPXISOX.25EncapAppleTalk %s: Protocol Family %d: 㿘?`q"T*` €q! q!0q!@q!Hq !Pq !Xq!`q!h `q@!x0q!@                     %-*.*s Address%-*.*s %-*.*s %-6.6s %6.6s %6.6s %6.6s %s DestinationGatewayFlagsRefsUseMtuInterface㿀"l`qq"ȖВ @ q  ""@`  "   "@`q "q  #"@`     "@`q qqqqqq#c (0#8c@#\#`#d#h#l#p@f%-*s %-18s %-5s %-18s %-5s %-5s %-22s SourcePortProtoSA(Address/Proto/Type/Direction)㿐"l`rq @> r rrrqr#\ ``@/ 㿘!#` 4 #`.%-16p (root node)%s => 㿘%#H T `Kbl r!@ bl 8r `!r!r!@ ,HW p`!  @bl H@NH   @\ ,``?"`` * "`@@l H  H0  HW p`r@!@$H`` mask (%d)%6.6s %16p : %16p %d refs, mk = %16p {(%d),%s ->㿘!HT!H  r@#xW  @?``_%0! !r @r#@k`%? )r!c!8-r+r j  @ݐU!8 8 r#В@K   @̖?`` }?"```* $`@?ِ } `@-c؀`͒``?"`` * $`@? route-sysctl-estimateout of space sysctl of routing tablex   ?''''   @E s@mv!@@ @ǻܢ 2s@!@6   @. 6s@m^!@( @ @  %-6.6s 㿘 L% `" $ 2    @; $  @5  L ?  M@ P  @(  s @b``?"`` * "`@?3 defaultlink#%d%s%x: %02x%02x%s  x?`t#*` €  `@@X`s# ? ?  ? ? & 2`@7` @@Ȑ@y|    2  t @ m  " `  t @ _`+t)t?$@`? : `@H@iD@K ? z $r @q: 2*:)+t)t?$@]`    2?$@L (   2 ߐ?t 0@0"@`r @0q"Ȗ@ hHHH4HHHHHHHHH4HTHHHHDдpWR ,Ѐ`  ,R@"` `*`R@ *@q %6d %8ld %6ld %6s - %.16s%s => expire %10lu%c recvpipe %10ld%c sendpipe %10ld%c ssthresh %10lu%c rtt %10ld%c rttvar %10ld%c 㽐 @֔  (   @͒  2 @\0 " @̾  (  @̵     4"@`  "  0   "@`"    ~  4slb 8u t@ h T`u@ x Puu @` P   L a``?"`` a`* $a`@=m  @!! `ɔ  @$!u ` u t @ a``?"`a` * $a`@=C !``+u P \   L `  L d  L#\@턐 Pu h   L l@  L p  L#\@o%u.%u.%u.%u㿐W`x 'D"`x"@D&! 2 ,b@l̒ . @\,b"@` D @A  @l . b@xr ", #a@E , D! 22v#\p2 `!@!!%u/%d%u.%u/%d%u.%u.%u/%d%u.%u.%u.%u/%d㿐"@`   `@  2`" @@ !"@ #c@ES , 6` `!v 6 #@d!*# `!6 v ȗ6   !6 6 v#\ؗ6  `#@J!#!6 6 v#\#`6  `#@;!#illegal prefixlen invalid%s/%dp`    ' `' '  ' ''' E @C`@ + 3` "$  "  `` " `"  "   ` 2 `  ` ``2+ + `@ Ĕ  ` `䀢  `耢  `쀢 `1s&#v!@cX"@`2 !#\ؔ! @r vp@!1 vx@!㿐  !!#\!! @T t ,!rtstat: symbol not in namelist routing: %u bad routing redirect%s %u dynamically created route%s %u new gateway%s due to redirects %u destination%s found unreachable %u use%s of a wildcard route 㿀 w@뽐"(03Ȕ w@뷐"H!w"Xݐ@뮐!w"xԐ@륐!w"ː@뜐!w"@듐!w"빐@늒*.%xH*.*any*%02x%02x%02x%02x%02x%02xH.%xH%xH.%s%sp 7  7 7 * 7777&7+  2#+` 2 2,2  #bx 2@А@T 1!x"@ƒ 21W"W @  Wx,   |@  2  x, 1%'#x# b x#d    #\#`  `@Lbؗ,`01% #x   K 0 *  2x@@{ ",Ȱ"`HȒ 2@p@0H.㿈 7777 7 7 77`x"@x  " %02x:%02x:%02x:%02x:%02x:%02xp ? / / // 7  / / / / / / // ///#/  W W #bx 2@ @!x"@ 2G"W @9  Wx"  @/  2 `x ! `*  `: L`#@L`+ +`#\#`Ox#d; ;`@Ғ  !x@#0@ɒ 1*#01"xH#0 2@@>㿈 7 Y7 77  Y// 7 7 7 7 //Xx"@wɔ  " %-18s %-5u %-18s %-5u %-5u %-42s %-5u %-42s %-5u %-5u %s/%-u/require/acquire/use/dontacq/permit/deny//in /out / 㼰 @g 0 @b 0 0h@] 0ʀ  !y"ڒ@鴐!y"ܐ@ʀ 2@jx@@( X@@$   /Y/y/X/x@/ ` @*!y"(@酐@@ @@ /y/x/Y/X@  @!y"8Ȑ@ij ilp А #\  @!y@T"P:y@P"X9`%*`z"0 €y@D"`y@?"py@:"y@5"y@0" y@+"y@&"`  y` * *y@"02 `` ` y yy@"0@"Ё,Th@ J(8f4 a* J TP_CONFIRMING(0x8)TP_LISTENING(0x7)TP_REFWAIT(0x6)TP_CLOSING(0x5)TP_OPEN(0x4)TP_AKWAIT(0x3)TP_CRSENT(0x2)TP_CLOSED(0x1)ST_ERROR(0x0)T_ACPT_req(0x18)T_NETRESET(0x17)T_DETACH(0x16)T_USR_Xrcvd(0x15)T_USR_rcvd(0x14)T_XPD_req(0x13)T_DATA_req(0x12)T_LISTEN_req(0x11)T_DISC_req(0x10)T_CONN_req(0xf)XAK_TPDU(0xe)XPD_TPDU(0xd)DT_TPDU(0xc)AK_TPDU(0xb)CC_TPDU(0xa)DC_TPDU(0x9)DR_TPDU(0x8)CR_TPDU(0x7)ER_TPDU(0x6)TM_data_retrans(0x5)TM_reference(0x4)TM_notused(0x3)TM_sendack(0x2)TM_retrans(0x1)TM_inact(0x0)$OpenBSD: unix.c,v 1.8 2002/02/16 21:27:50 millert Exp $Out of memory (file table).  `!H  @t| `  `{@!H00 *`" *   "`d$"h h hT h ( h`   h` h (@Lh 8* seqpacketrdmrawdgramstream#0Active UNIX domain sockets %-*.*s %-6.6s %-6.6s %-6.6s %*.*s %*.*s %*.*s %*.*s Addr AddressTypeRecv-QSend-QInodeConnRefsNextref%*p %-6.6s %6ld %6ld %*p %*p %*p %*p %.*s( 粔 8 h `  稔! 2  'W< '{@獐"{ {{{!{ (08#@#\{{{{#h#t###"Ȗ#c#`#d#l#p#x#|#@k $H"l`@P "@2"l`@P| @&a`` ?"`a`* $a`@4 %s: %ld packet%s with short headers %ld packet%s with long headers %ld packet%s with no checksum %ld packet%s were too short %ld packet%s with bad checksum %ld packet%s with not enough data %ld packet%s forwarded %ld packet%s rcvd for unreachable dest %ld packet%s dropped due to no socket space p  $ ~!@䬒Ѐ !~!`4 !~!ʐ@䛒Ԁ !~!`4 !~"乐@䊒؀ !~!`4 !~"0䨐@y !~!`4 !~"P䗐@h܀ !~!`4 !~"p䆐@W䀦 !~!`4 !~"u@F耦 !~!`4 !~"d@5쀦 !~!`4 !~"S@$ !~!` #C@mroute6pr: symbol not in namelist no IPv6 multicast routing compiled into this system IPv6 multicast routing protocol %u, unknown mf6ctable: symbol not in namelist miftable: symbol not in namelist IPv6 Multicast Interface Table Mif Rate PhyIF Pkts-In Pkts-Out %2u %4d %5sreg0 %9qu %9qu IPv6 Multicast Interface Table is empty IPv6 Multicast Forwarding Cache %-*.*s %-*.*s %sOriginGroup Packets Waits In-Mif Out-Mifs %-*.*s %9qu %3d --- %3d %u IPv6 Multicast Routing Table is empty  @l!0G#?blt ``g@_"0:@Z"805`@S"h0.@M"0(?@h ? "@ Jbx  b/-%  '; ؀`. @(⸪ .  2`@" `#0@Ē# @ ( (  @  *`2  ? Ҡ ``@#8$  *``?cpc`#  `73@#hc`#@    'c  '@   c`#@    c  @  #\@#` c`#@    'c  '@   @└c`@    c  @  o@y`# @s   3x    @cc8?#@@Z#?@V ?c   3. 2 2 *  ,@  @D` *`2  @ @; 2M `$>*``@- (@*` ?h$@mrt6_stats: symbol not in namelist multicast forwarding: %10qu multicast forwarding cache lookup%s %10qu multicast forwarding cache miss%s %10qu upcall%s to mrouted %10qu upcall queue overflow%s %10qu upcall%s dropped due to full socket buffer %10qu cache cleanup%s %10qu datagram%s with no route for origin %10qu datagram%s arrived with bad tunneling %10qu datagram%s could not be tunneled %10qu datagram%s arrived on wrong interface %10qu datagram%s selectively dropped %10qu datagram%s dropped due to queue overflow %10qu datagram%s dropped for being too large ( ኔ ``g@u"0@p"80`@i!0s h@b!!ሠ!ؖ@X!ሠ"@N!t"8@D!j"X@:!`"x@0!V"@&!L"Ȗ@!B"@!8#(@!.#X@!$#@!#@!#@㿘@unionsoftdepsynchronousroot file systemread-onlywith quotasnosuidnoexecnodevnoaccesstimenoatimelocalexported read-onlyanon uid mappingNFS exportedkerberos uid mappingexported to the worldasynchronousffsAadfo:rwt:uvonly one -t option may be specified.rorwrqnoautogetmntinfounknown special file or file system %s.can't find fstab entry for %s.%s: unknown special file or file system.%s has unknown file system type.:@nfs/var/run/mountd.pidr%dsignal mountd㿀@x #ظ   75 # %W/ +2'쀢 8-* @@€ (  %&x"bJ@ @u , c@Ԑ @(b b@  %` ?@@c?ː?c * & ^@   0,06.`? @k  @k  @k( @   @ 0 @Ր     @q#\ 2 @}k 0@  @`8@N  @ D "@ǐ!@ސ, @@t@@^@ '@`H@G @}^ T 2& @`p@= ) T@}Q@  @}7@ @`@+  @j  @j   @j( " @`@    #\ 2`@@;耢  @@Ŧ 2`@#\ @@ `&@R !`@9 !@{  @ ?  b a @ @|@G00 0000000000000000000000000000000 00 0 00000000 00 0 (,㿘N@ n N` o `@aw # n J` o  `@7/ "   @7( 2 `?  @|c( 2J@@/usr/sbin/sbinrealpath %s/statfs %s%s on %s type %.*s: %s already mountedforceupdatemount_%sexec: mount_%s %s fork%s/mount_%sexec %s for %sno mount helper program found for %swaitpid%s: %sX@ `    O@   @`@`(@i[ \@( %@= Ӣ@k˔ Z @kÔ   !`` @`Xn@  @Q`h@J`@@B`px$@^'h $'@[ * $  '* $  x* '$ @ݺ   6 #,  @ݯ` , @ݨ n @?  W0-@t @^ #;9 5$`@@"`@Z  2 "` @M@ @b@) @? +   >   0"  !@惠!@[  !`` @l  0@ 0@n %s on %s type %.*s%s%s (, %sunknown flag%s %#xs, ctime=%sv3v2udptcpsofthardintrnoconn%s%s=%dwsizersizerdirsizetimeoretransmaxgrouplistreadaheadmfs%s%s=%lu %ssizeadosfs%s%s=%u, %s=%uuidgid%s%s=0%omaskmsdosshortlongnowin95gemcd9660norripgensextatt) h  T !@@ǘ D >a` *   W!Xa` @ܳ W"0` D#3"0 `-+)@`  2 Xa`!h@ܖ ,@`  뀌@`!p!`!h@!  @v`   4'Ԓ@H!@h/`@g !X!!`!h "!!@L   @ !X!`!h@8  !X!`!h !!@$   `!X!`!h @  " !X!`!h @  @" !X!`!h @  `!X!`!h @ߔ`  `!!`!h @ɔ`  $`!!`!h @۳`  (`!!`!h @۝`  , `!!`!h @ۈ`  0 `!!`!h @s`  4`!!`!h @^`  8(!!`!h @I(b8@f} @ꊒ̦"@!`!h!!x@'"P@(bX@f\ 7`  ! l  p `"`!`!h  lp p@"x`  t̀"!`!h @b@f! {`  ! l  p `"`!`!h  lp p@ǘ"x`  t" x"!`!h @ڲ x !X!`!h @ڡ x !X!`!h @ڐ x !X!`!h @ x K!X!`!h @n=@eb 7! l !X!`!h @T l !X!`!h @C l !X!`!h @2؀" @)㿐@5  @6  @eQ  @eJ T `@! 㿘W",  aP`?  # @g    2aP@ empty type list㿘 N  nb@   N  o   "aP "!P %W  @Y6 , ` @*  $, @` $@ , `$@  @Y , 2*@, $@%s,%s㿘 L@ @@ @[  @5 @ `@\F`@l-o㿐@'!%  -, &@Xے =  ,  .&` @d  ,  `H, &&  @( 2N&@usage: mount %s %s mount %s mount %s [-dfruvw] [-o options] [-t ffs | external_type]special node[-adfruvw] [-t ffs | external_type][-dfruvw] special | node㿘a@p!a@a!@V ufs%s: fstab uses outdated type 'ufs' -- fix please%s: fstab type %s != disklabel type %s㿘 @d `  @5^`耢 2( @P "" @d   @d b 2 c@d 2 @̐"  "H@Ŗ  ,-o %s: option not supported㿘@[q  @P 1' n L  o  @X  = 2*`"@1 2   @2    &*@&cP@@  @vޒH 2L@^㿘@㿘@p @[㿘@㿘  ?R$   @ 4  H @ 0? @   @2    @"`  @?`  "  smcuprmcup㿘 ` $`"4$0T!܀ )3! `$!a@@!! @ 0 3! $!a@,!! @֒ @a`@a`' !  @’ !@ϼ @ِ!`  @" "`@ 㿘 `$@|J! "&"X K"""X 2 ! n  !!,""X    !"X$"&@ "X!&@ 㿘$ ` @ 1 !̀ " !! *` * 8`0 @ 0@ 0 " !! *` * 8`  ` @X  㿘@`8`?耠"?P"@耠"?P" H@ "@㿘% /@ & `?R@耢?R4@耢@H ? @X ??  @͢ @L@O?8`?㿘 ` $`w! @Ւ !!`l#D @ @ƒ ! ``?"``` * "`@&` !@Ϋ 0F!!`   ?`&  @ !`* $!`@&F< !`   ?`&  @ !`* $!`@&/< !``?"``!` * $!`@& @!`0@ 㿘`@Ē 8`? ` $ ` `"  *`?"" Error: move: l(%u) c(%u) o(%u)㿘 H@@?   H@  㿘  $a ``@­ @`8`?xterm]0;%s㿘  \ $!  a@c  !`&!!@@ !`0 !` &!!@ @!` `   $&@$ !"@4   @~N! @K !bT  @~DP  `?R@`耢?R#D `@ @'``@)5   @ !@~"  @ !`" ! ?$$! `@) `@f    @Ā    "   $a" %susage: ex [-eFRrSsv] [-c command] [-t tag] [-w size] [file ...] usage: vi [-eFlRrSv] [-c command] [-t tag] [-w size] [file ...] 㿘!`@@{HTERMunknown]0;%s㿐@m a  "a@U@@_! @x$!Ф@ 2@!@@@W $`\$``@@   @p "@b $`D$`Ha`$`8$`<   @ɐ@֒ @N @@2@؀  `? @ !@@ @a @O@U@(㿘@) / 2  @?( 2&@W &/dev/ttytcgetattr㿘 @)!䰒 2$`$@@A $`$@ "hT!"&! $hT!" @!?"@0# @ݔ ?@!?@@c @א @h@ѐ%s: No terminal database found %s: %s: unknown terminal type 㿐 @,"?  0!`@z@ !`8@z@  В  $ ᤄ   $!@"! В  $ ᤄ  $!"!signal-reset㿘`4 $ 3 &aԔ@T! 2&a &aԔ @I! 2a &a @=! 2a &a!̔4@1  ", @ ' А @$  @  @  4 @  P@X  㿈'''@s㿘 $ !@k  !@g  !@c !̐ @_ 㿘3579;!#%')aдT!a(x bhPl a  ax⨨"&(&(X&(\&(`&(d&(l&(p&(t&(x&(|&(&(&(&(&(&(&(&(&(&(h&(%s:%s 㿘!`H@y’`@y b!@H P@y@ 㿀  $! @ !`@ $! X&` U&`$   N&`! I&` >$! @䀢 <   @  2&` @Z#'#@<* "@*`@*`'0!@$`"h*` € &`&` &` &` &`@  B$B<BH@Ainput`$!" @ߐ 2'    ??p?x?' 'pp 'p  @M ? `0 `0, @ Ȁ 2(T`  ̐ '''''''Ԅ '''' @{ T  @{!\T @  ?pp??x?'p p3@ d"`2`*@ `.  #@ 42d  @M ?$ p@l @L] Ű 06 @J2d!  1$! ! .'  "`  @ `   ?` "' !*'$! `  @zȁlines=%lucolumns=%lupР?''''$@@!'@ 2 $@o@'@u @ 㿘 (T   $@j 2e (T ?$(T`$`2[ ``2V $  ?&$$  &$ ! H  4 @  @ȋ  4  H@ @ @  耤)@ 2. a $a$`"' a"# " " " "  *` 8* ? @l @r   @]  a ? $a 㿘 $!  # @ 2 ! ""2!@ 2 ! "" @ 2   @yÔ!! $!016|Vi's standard input and output must be a terminalTERMLINESCOLUMNS%s%s: unknown terminal typetcgetattrtcsetattr㿘  $a a\"@Q   @   >@ 2 #耊 " ## * * `8@!!P@BX @t @8" "  * * `8@` @a @%!` !X * * `8@@Q a`! $"@ `"  h@5 e p@- ]  @aP @X2 @` j@ !@ v@%p @#  @$  $aܒ @   @a\ @ + a"$a\"$a\a$"aha\$$a\ah  $ah,a~,aw,au,av,a{,az@ 2 a\ @xԒ   @Ւ  @ 0 㿘! $ @# !`  @   @ǘ?D  @ @  @@x&!܁ cupsmsormsoelcuu1㿘  $! K!0"Nap@Y!ax@T!a@O!a@J!a@E!!` ! 2! `@ $!! "! @$!! $!8!!$!@!$!D!$!H!a!! %!$$!L!($!P!,$!T$!X$!<$!0$!4!0 @xI   @H  㿘 $@# 㿘@ߐ " @ "  @y & @(  @y 㿘! "!@&!! "!@&!! "!@|&!! "!@u&!! @n&!%lup` @ (@@8 SSSSSShS`SXSHS@S8S(S SSSRRRRRRRRRRRRxRpR`RXRPR@R8R0R(R RRRQQQQQQQQcursor upkkcuu1cursor rightlkcuf1delete to end of screendGkedscroll upkripage upkpppage downknpcursor lefthkcub1delete lineddkdl1insert at cursorikich1go to sol^khomego to eol$kllscroll downkinddelete to eolDkelcursor downjkcud1delete characterxkdch1insert lineOkil1S`T(SHRxT R`QTQQTQlakahaja㿈 `%  @ "@@@#\#`#d@M 2  #`0)Z   @k " ! !Ԣ`@ 2``"@\@Y`#\#`#d@ 2_  #`"B   -@9 4"3@YF0 ". @-@*#\#`#d @@@#\#`#d@    !D " $     @=  2 $ 㿘!D`  `$ @@c 2 `$ 㿘$    " @ kf%d233|This terminal has no %s keyfunction key %dH#c@# @@ @  " @ ` ` !@8  #@#ِ@ @ ?8 ?@ #d#\#`@G㿘 ` $`>` `" (T0,`I"0' (T`"(T$  &$  @0`?0   "  0 " ```   stderr%s046|messages not turned on: %s045|messages not turned off: %s8@s    <@w 7 @O 6a؀ .(Ѐ     &a؀@ֵ` 6 ?c @֦ 6  @A  TERMlinestigetnum: linescolstigetnum: colsLINESCOLUMNS㿐  '`h @?  `1 ` 2q'0oi" " " "  *` * 8 0YW!` " !X!X *` * 8@ ܀0G@؀0C`( @#0 ! `@P#8 6 @@Ӓ `` @@#P 6 X@Ò  " `" P@#h  @(Ԕ @~#p  @(˔ 2&2& 㿘!``? "`` *:  !` * #!`@ 㿘  `C  @  2 @ @#\ ` `  "  H*@ `#\ ` ` H*@  ` !@ $ `      2   @" @ 1 !$  @w  2,  @   $ $  a@ $ !@"` "a@ !@$  @B $ ,  "  , @8>  ?@ ^`@/ @"  ?@ I  ?@ >`@ @  @~ ,   "! #\ `2  1 H `e 1 !@  `  }  z  2s  m  @ΐ , $  㿘 !@) ?π` "*` € 2* 3* 4* 5* 6 * 7 * 8* 9* 2  `"  "` "@@ @b4b@bLbXbdbpb|bb㿐 @x 2(  @F    "" @@&  & &  2 ' "'     ' 㿘!@  "@F `"  "` "@@p!@ 2 !,!,@0㿘 @uܒ <  @  & @( &  @ה   `@B  @& 㿘@& "`@&"@@ 2㿘  @@002|Line length overflow㿈/ @  ' @x^  d d@& d  (T`Đ  @u=   (T`@? ' @y 2      @w쀢 2  쀢@`? k @'' @x _ d d@& d  (T`  @t   (T`@? '@ @wt쀢 2s    `T! ' @7耢 !x t@+x "Q &ttx'T!&T@``@@x * < @ 2Q` @w1쀢 20    T!"x ' @耢 ޤ` t@x " &ttx'T!&T`@ `" `@`# @@xm" נ ՠ 6 @vߘ 2ް    !T!"x ' @耢  t@x " &ttx'T!&T@I @v쀢 2 쀢 [?@W"  @<       T!"x/''   "TtTx >&T  t@Ex "k &ttx'T! &T@4耢  `@" "@ @@wƔ 20 @ '' @v # d d@C& d  (T`  @s   (T`@? '     ` `thT >"hT@script 170|Interrupted㿘`@a "lܰ  `x   `"  "` "@@ @l 2T ! $$?#a *  p+$d @i 2 @&@" $d@ @2d`L@Δ d $d@< a<`"a4a4`*` * 8@2 @ b ` @ b  8bؑ*` * `Tb؀ T "T :@\8 2Y `(T`  @rĖ   `(T` a@;@;͐ @M`x` 2` $$$`$ $@ "`T 2% `(T`  @r  2T`(T` T "T @aT 2&dV & !#&*<=>@~080|Unknown command name1bca1082|%s: command not available in ex mode083|Count may not be zero084|%s: bad line specification085|Internal syntax table error (%s: %s)lr086|Usage: %s088|Flag offset to before line 1089|Flag offset past end-of-file090|@ with range running when the file/screen changed091|Global/v command running when the file/screen changed092|Ex command failed: pending commands discarded093|Ex command failed: mapped keys discardedx  |` "`` %`%`@ @vb L  ѐ & P`*@$`` @   %` ``* $` $``   3@Y`Q`@$`@z 2 T` $` `` $`$`` &:`J   %` `$`  2`  :` ?  $```$`J`:"``  "`?  $`` $`J  2``J 2|` `@ ?$`$`y$`"`` J`?$`  $`J "` "``   $ `("`@ !  3 |` " /'L``   *`J` *$` @    쀢 2`` u ` J`?$`  $`J "` "`:"`` ] `J`|X` V@E"!`   ``?$`$$`` `#\ @ ` "` ``$``$`  `2``2 Lp * : I  x* €c! 'JL   'JL L l p + - ^ ##``"@! $`0!Ę!!`$!$`!$`!$`$$`($`,$`4$`8$`0a$` `H+   ,@  T$` L k s0> <``?`p$`$`@$` ?L  L c" g" r"#`?`" $$`($@$X$`$$$`$$`$`$$`,$`0$`4$`8$`($`  b*  ,@ Ɛ`` "@$ `$` ` ! #H H !Ӏ"#X "#P#P *` * 8`2  @_ ` 0 `0L < `02&` L >! `+ `: `J@2```$``$`J"``" @ 2S`` #耢@  "@$`@2`%`(`*@#H$` ``(``@$`$@2 ` $`` L`$`d P$`h` $`" """ *` * 8`2` ` " ``@`| b$`4`|@*@$`$  ` $"` $` >$``` !  @  $`@h@@v8``"``J !2 ``|!$`4`|$`$``  5` J`$`` $`J "` "```" ``J +2``$`$`:``@ J 0  'S ` 0 'R @n   `` ` $`$`J    "`,`` $``$`ʨ `$`֮"@x@P@0X` ` 5`J\ `` J  $`$` J`%`  $`  ,`` $``$` @Ȁ@:' 5``?`$`$```  J   '쀢~!2}`` #@쀢 "t`J "p```$``g$`J 2`b`@ ]5`  J`$`` $`J "` "``#\  `*:  |2`#$$`($X$`$$$`$$$`,$$`0$`4$`8$`(($` `%$``$` `J \2 ```$`$``J@ "`` $``$`2`` `J@ @ Y```@ J 04  'S ` 0* 'R &@l " `  `J ` '쀢`|2%, 2 ` %` `$` ` ` $`$`쀤 |2, 2``  $``? $`,`` $``$` ```$ "`$`` $` $` $`   L \",` `c`` 050 `` "  "`l~@$`` $`@qے耢 2`耢 2 L`$`d $` L$`d Pd$`h$```p$`d_$`h] 0( & @ $`$``  $`l@q`l 2```   `l  `$`$`d$`d`$`p $`6$`h "*`d2 20` ` $``$` L 2$`d @q耢 2`耢 2  L`$`l $`$`d L$`d$`l P$`h $`p `h$``$`l$`p 2` ` @,  $`` L`$`d#4   L#, *` * 8 #,$`l P$`h$`p@qG耢 2\`耢`" `  L@(` `l 8$`l` $`\ L`- !2``""`J@ !2`|`!$`$`4`| "`` J`$`` $`J "` "``  ϑ* : Fݘ #\* €` ?#`J ^"`\ l +"`\ - #"`٤" `\դ p"`|Ϥ $`\?$`\`| b$`4`|`(" %`(`|$4`|`(d 4`|`(@ %`(`` $``$`` "`J ."`| = + -" `| ^" `|   @`| ( L 32`| 4`|`` $``$`y`J + - ^ #2 `@@ 1 2h`#\  ` 2_``|?`,`Q$`$`T4`|` c\ ` L +2H*:  + -2A`J - +`| 2``| 4`|`@ 2G䀢 L 0*``"@ " $`$`L a `l`p$`d$`h ?$`l$`X`|  4`|`@ ـ @a u쀢 ܀ `@oȐ $`T ` #В@ ``?@ Q ``'``?``@ J 0  'S ` 0 'R @jY  `  ?`$`$` ,  2 ,`` $` $``` $``$`$ @  2`` "` ` J`$`` $`J "` "`` "` `'``6!``@J"`",   'S `"`, 'R @i 2,`  ?`$`$` ,,`` $``$`$ @  2U`]```@ KL NQ?'L o`$ "J`` 2>` E``` b ` *` *  !X@+ :`@i@w L  ` `? $`" ``J  $` ` 2 ` @b8 " ```  @@w ``` ( 2@$`l```2`d$ 2` @2`d` ֔ @n 2`d`| ʐ@n耢 2`$`l`d`` $ 2` @2 $`  @np $ `@B@=<``  21``l L   '`# " & L& P@ P``d L   `  " & L& P@p P``$`$`@ L  P''`* $` '@vO 2\`$ "  , & ,  $@2`@n` @" `   "`$ "`T 2`@2|` @2`|€ ` *@$`` `€ 2T (T`2T  @iw  2$ (T`" $T " `$$&$ " @xA  "&$`\""$ L @ٔP8   @ `@ @m 2 LƔx L`\ & L$ G  C L ?`|`:! @4`|`@@<`|! @4`|`|"@ $@ ! "!! *` * 8`2`  ` @2   L''@/ 8`@J?`"`!` ?   'S `"`` 'R *:`@g 2 `` $`*` $```"$` @$``@$```$`$`$"Ȥ   |`# `P`#8*` € 2@ 2 @ؤ @uϒ @@e@`2 `P pn$"@2y'|Ȑ@u ``@v `  @Ֆ ` @ϔ ` 2@`` "<`! `J` @$` 0  'S ` 0 'R @g\  ``` $` $` |2 `` 8 $```? $`` |@" @uR @v@jC  P@uF  '%$*@&$tP hy<y<yXyXyXyXyXyXyXy<yXy<yXyXyXy<yXy<yXyXyXyXyXyXyXyXyXyXyXyXyXxT094|The second address is smaller than the first㿈&`  &``` @ ?* : `2r!`*` €`@2    @k`l ǖ `l` `@ `?&`d&``&`&`&`p&`h`@2հ    "!``` " L  " L`" `l` &`d P&`` &`h`p&`d&`h L &`l P&``&`p`J`;2``` "`d  `" `l `@& L`h& L`p& P` `?&`9&`@ޘ 2  쀢 - \`` "   ` ` &`d&`h&`` &`l&`p &```l&`d`p&`h&`l&`p ` 2O``@2M ;`` "2 L   02"&`l.`` L&`d P&``'&`h  @ .   @  (   @ ! !   @  `p&`d&`h L &`l P&``&`p`` 2 `d`l @s  & ,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,, $0123456789'\/?.+-^095|No mark name supplied096|\ not followed by / or ?097|Reference to a line number less than 0㿈'&`* &`  2``J@:A"0     @t '` @ ?ܑ* : `8!ܓ*` € &`@&`&@ju 2 `` ? &` &`` @ @? z'&&``""@&`&` &``  &`H@r _'`J @q "`T'` &`j&`` K  / ?" `h@rԒ  ` ?&`&`K `/2;:#;#| L@& P&`` ` p!p#\ m  ``" " &`&`&` )&` & P& L 2&@i "  "`&`  `c\  ` ++` ?&`&`` Ơ `J "` 2```?&`  &`J` "`` "``  `  c\ `2 *:  + - ^2 2 ` & L& P&` &`` \`J "` 2```?&`  &`J` "`` "`` i\`  ` 2 *:  + - ^2Y \ `2`  `2 `+2? ``?`&`&`J@ - ^ ``?&`&` ` @2  ` " $   ` $ :  { `$``" " &`|&`  "    @q ^ 8   S @& X@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@㿘$*@ &$|@2 ``@n @`i$` 2g `P "A@`<`<  @@ $`@"` @$`<"@@`<2 2,`H `P `D`@h- " `D@hW L " L+   & L@r`H@`"``"``@"@@g|`L   @$``L$` & L$`D`$  `P $ &$ 㿘 `|`"1`| P ` < <@@`& @"`@& <"@-  <@2@@' H`"  "` "@@`|2 P`|"  098|The %s command is unknown㿐    (T!" x ' @ 1(  t t@ x %$ t t x'(T!$(T,@@_ ᠐@q   ` `t@hT >"hT@Ő㿘@$    @%@ 㿘@J?`!  @   !А@`?㿘c cLJ@4 2  @k   2 099|Address value overflow100|Address value underflow101|Illegal address combination102|Illegal address: only %lu lines in the file103|Illegal address: the file is empty104|The %s command doesn't permit an address of 0㿐"      @oÔ 0:,)  ` @@Q 0('" . €0@f P@o 0@o 0 @)@@o 105|No abbreviations to display106|Abbreviations must end with a "word" character107|Abbreviations may not contain tabs or spaces108|Abbreviations may not mix word/non-word characters, except at the end㿈`x  "`t0 @ 2q  @o7 j @@` ?\@ ` 2 @`_R@@ "@  Bx  @ `#\  ` _2    ` _   @ `  #\#d@N#` 2  hT  "hT@nΒ  109|"%s" is not an abbreviation㿘 `t(T @@`@͖ "  @@o  㿘@ 㿘@ 㿘@  273|Entering ex input mode.㿐    `  @P` 0`d & L`22``d `d`l   2Ѱ Ɩ  2ɰ ` C`%    2? 2$ $@&   .2  ?@dU  }`  ?  @dF n` ǖ 2&`&`$@u``&蠟€  `  @O 0o$!2  ``&$!@) @sa@)!@)@)Đ`|!! "!! *` * 8`2!< "!<!< "!4!4 *` * 8`2@  @  ?''@Iߔ  @```@c̒  `@@2`` & L@d   & L 111|No more files to edit㿘`x `(   2`K `!"`|`x 2`( @@  @R}@}y a@[  r `x Jd@2d`$ " d@  @`$d* $d$`(`x @`%   $`$  @m.I `t `"$@ $ `  $`$$`(@R d $d `(@R d@  2`|!  $ @S_    "d`( $`(d ($d㿐 @ 3 @9 `t@R  `|2 @S2  @7 @ 0 @"`("`$  "$@ $$$ 112|No previous files to edit㿘`(`$@2 `@l 5 !"`|@1@ ' @o" a@Zٔ   `(@RZ  `|!  $@RԔ   `( d($d$`(113|No previous files to rewind㿘 $ 2 `|@lH !  a@Z  2  $& (@R" " `|!  $@R 2 $ &$ 114|No file list to display %s%s%s[]㿘 $ @l 0Q   H)'-@ (  8@ ?@   @'#  (" ( @' ( #Ȁ #Д؀ #ؒ @'` hT   @^  2  (T`  @'j# 㿘` `x @^   @k `2`t@D@7 &  @ `"$@@& $`@`  $㿘  @Y$ $ &`t $&`x 㿘 @N $ *  @V $ *` * $ * "` $  $ $&`t $&`xx    (T!" x'' @o" "e '쀢!  t x@c" "Y $ t t x''(T!$(T#\#`#d'@ʚ    ` `thT >"hT@u /  @ @  J@  J@ "` "`@ y   ` `thT >"hT@G  echo x  ` (T!" x'' @" "̰ '쀢!  t x@" 2$ t  t x''(T!$(T  *@  *`  *` *` + '#\#`#d@5 2  3@y  R  4@y  K cp " chch`* * `8@N    #\ ` J?  ? # N@19  0  %N   \@ `2 ? @1"  ?   ?'N * .@@]  @` `` `thT >"hT@a 㿘z "xN N " ""j )`N  0  'S ` 0 'R  @[     ؤ@$*@ " @ ))`" @L@ "` @   'S `"` @ 'R  *:`@[c 2 @` @,`ܠ ,$ $$&`t$&`x 115|No previous command to replace "!"116|No filename to substitute for %%117|No filename to substitute for #㿐\`@d'@+N #"`  % ! '`@ \'`"`  @Ш'@    "(T t(T x >@  '(T t x@E " ' t(T ta x' '(T@ @3 ӠN  @'@    "(T t,@@'@    "(T t(T x >@  '(T t x@ " ' t t x'(T! '(T@ @ @`@@&`(`N % # !2`'`    "(T t(T x >@  '(T t x@ "^ ' t t x'(T! '(T@ @ B, "'`   `"hT`thT`x >@  &hT`t`x@ * &`t`t`x'hT!&hT@@n  x@h+   ,'@%` "㿘 ` `$@&"`` @X,  @,  $` @h `2` @e? * @U P$` `,   @Zڐ ` "@ @g ``!`  #$  $ @  @Z $ @gǔ   $ , $  @g   , `,@   @Z ` "@ @g ``, "`㿘   "& $  @ ,``"  ` " @@ @@ `@& @ & $& &  ./%s304|Shell expansion failed㿘@3 / "X  "` ,@ @@5Y 2M$h@h _ 2  L  .? @ݐ@ؐ@ 4@b -@ `$`*` @ `M / /, `@$ *` " $`$$' t$' x@6ِ @6b$@  .` "@7H  p@f  㿘@@@9289|Shell expansions not supported when the secure edit option is setpiperfdopenvfork-c118|Error: execl: %s119|I/O error: %sx'D#X'H'L 'P#P *` * 8`  DDcP D/  cd  Dc\`* * `8@'#\'@S / '' 'H?@'L'@''@  D @fc @THa  'D(@fV @3 D0@fE 쀢 "@K?"@~? @~ @ @~@~@~ 8@ Dܖ@@gc @ @~wC쀢`9D     t@L(T >&(TL x*`  x t@.D "Z & t t'L x"(T!&(T@*  D@L "E 'L@"@'. ?'`? "`@N@  "@䀦( .N?  2.?.P"@H"` @@K  DX@f   D @*q 2 N  N " "" ``Dp@e} `@ 㿘`|  @`Q ` @ *2 . $ @2  9 . #\ $ ` &$ ` H+ @  `  !@     2  +  * !X@ @Vm @G  0^@X 4`<$`<$`@ @X  ,``d " `P"   `P`l " ,`P`<"`@"$`@"`$`<    `   @?.` $` @d " $`L$`H*   @  @ .@ ` `| $@`|"  "`|  |$` !!%s 303|File modified since last write.! 㿀`t@` 2  `  @F 0  @@.@ $  @d  `@$@2```@a@ ``@a@ @ \`` L  > X ";$!$ "!! *` * 8` $T  @Sd  "#$m $T "$L$L *` * 8`2$$ "$$@2 $a@i^ $ @`?@(b:$ 2 ``  @F 09 `d @`&``l 2@@[i쀢 (  2@&`l&`d @`d`l#\@ $ & L& P@a P$& P$ @2 @a8 120|File modified since last complete write; write or use ! to overrideHOME121|Unable to find home directory location%s/%s122|New current directory: %s%s㷘  `X "`x`|!2`x  J@/h@c  `x  "#`t0$@t L @P@V   "J  @c k @@@M 2`x_ V`t `/"P  `.H `.2 !H  .2 !H  /; :!H " !@!@ * * `8@ ')`N@ @ :2`(.@@a@.@@ 2N@@n(  @dt   N@ ږ`@dh  V<xX( VlXHxhPHB &@1,BxHxhP`1H0 ixp"h@( M`B`XP8BX( ##h`&P( i$/Ph`X@81 AtBJTphV @NBJTpFxH@KX8(Vl`XS8VTP4TP4p8(T_qxpPH`X8( aD1Ux8iXP@Pkphh` TxhH@0H(M`B`Dʜ`80< T4@xXH 8 I/xp8pH@!8@#`X$P( $Pt$Pph$H@8`0X replace previous RE with previous replacement string,[line [,line]] ~ [cgr] [count] [#lp]~display different screens of the file[line] z [-|.|+|^|=] [count] [flags]3c01zcopy lines to a cut buffer[line [,line]] ya[nk] [buffer] [count]bcayankexit[line [,line]] x[it][!] [file]xitwrite the file and exit[line [,line]] wq[!] [>>] [file]wqwrite the file and switch to the next file[line [,line]] wn[!] [>>] [file]wnwrite the file[line [,line]] w[rite][!] [ !cmd | [>>] [file]]writedisplay vi key usage statement[viu]sage [key]viusageedit another file (from vi mode only)[Vv]i[sual][!] [+cmd] [file]enter visual (vi) mode from ex mode[line] vi[sual] [-|.|+|^] [window_size] [flags]2c11visualdisplay the program version informationversionexecute a global command on lines NOT matching an RE[line [,line]] v [;/]RE[;/] [commands]vdelete an input or command mapunm[ap][!] word!w1runmapdelete an abbreviationuna[bbrev] wordunabbreviateundo the most recent changeu[ndo]undorun the tcl interpreter with the commandtc[l] cmdtcldiscard all tagstagt[op][!]tagtopmove to the previous tagtagpr[ev][!]tagprevreturn to the previous group of tagstagp[op][!] [number | file]tagpopmove to the next tagtagn[ext][!]tagnextedit the file containing the tag[Tt]a[g][!] [string]!w1otag[line [,line]] t line [flags]tsu[spend][!]suspendsuspend the edit sessionst[op][!]stopread a file of ex commandsso[urce] filef1rsourcesuspend editing and run a shellsh[ell]shellset options (use ":set all" to see all options)se[t] [option[=[value]]...] [nooption ...] [option? ...] [all]wNsetrun a shell in a screensc[ript][!] [file]scriptsubstitute on lines matching an RE[line [,line]] s [[/;]RE[/;]repl[/;] [cgr] [count] [#lp]]re-edit all the files in the file argument listrew[ind][!]rewindgrow or shrink the current screenresize [+-]rowsc+resizerecover a saved filerecover[!] filerecoverappend input from a command or file to the line[line] r[ead] [!cmd | [file]]readexit ex/viq[uit][!]quitappend a cut buffer to the line[line] pu[t] [buffer]putedit the previous file in the file argument list[Pp]rev[ious][!]previouspreserve an edit session for recoverypre[serve]preserverun the perl interpreter with the command, on each lineperld[o] cmdperldorun the perl interpreter with the commandpe[rl] cmdperldisplay lines[line [,line]] p[rint] [count] [#l]printenter "open" mode (not implemented)[line] o[pen] [/RE/] [flags]openchange display to number lines[line [,line]] nu[mber] [count] [l]numberedit (and optionally specify) the next file[Nn][ext][!] [+cmd] [file ...]!fNnextwrite a .exrc filemkexrc[!] file!f1rmkexrcmap input or commands to one or more keysmap[!] [keys replace]!Wmap[line] ma[rk] keymarkmove lines elsewhere in the file[line [,line]] m[ove] linelmovedisplay lines in an unambiguous form[line [,line]] l[ist] [count] [#]listmark a line position[line] k keykjoin lines into a single line[line [,line]] j[oin][!] [count] [flags]!ca1joininsert input before a line[line] i[nsert][!]insertdisplay help statementhe[lp]helpexecute a global command on lines matching an RE[line [,line]] g[lobal][!] [;/]RE[;/] [commands]globalbring a backgrounded screen into the foreground[Ff]g [file]fgdisplay (and optionally set) file namef[ile] [name]filedisplay ex command usage statement[exu]sage [command]w1oexusage[Ee]x[!] [+cmd] [file]exbegin editing another file[Ee][dit][!] [+cmd] [file]f1oeditdisplay buffers, connections, screens or tagsdisplay b[uffers] | c[onnections] | s[creens] | t[ags]w1rdisplaydelete lines from the file[line [,line]] d[elete][flags] [buffer] [count] [flags]bca1deletecreate a set of tags using a cscope commandcs[cope] command [args]!scscopecopy lines elsewhere in the file[line [,line]] co[py] line [flags]l1copychd[ir][!] [directory]chdirchange the current directorycd[!] [directory]!f1ocdchange lines to input[line [,line]] c[hange][!] [count]!cachangeput a foreground screen into the backgroundbgdisplay file argument listar[gs]argsspecify an input abbreviationab[brev] [word replace]Wabbreviateappend input to a line[line] a[ppend][!]append@ [buffer]@shift lines right[line [,line]] >[>...] [count] [flags]>display line number[line] = [flags]1=shift lines left[line [,line]] <[<...] [count] [flags]<execute a buffer* [buffer]b*repeat the last subsitution[line [,line]] & [cgr] [count] [#lp]s&display numbered lines[line [,line]] # [count] [l]ca1#filter lines through commands or run commands[line [,line]] ! commandS!scroll lines^DX8  $xpP@88Discard all current cscope connectionsresetkill numberKill a cscope connectionkillhelp [command]Show help for cscope commandshelpfind c|d|e|f|g|i|s|t buffer|pattern c: find callers of name d: find all function calls made from name e: find pattern f: find files with name as substring g: find definition of name i: find files #including name s: find all uses of name t: find assignments to nameQuery the databases for a patternfindadd file | directoryAdd a new cscope databaseadd309|Use "cscope help" for help㿘 $8   @l " $8_  ,$8`t@ #\ @ `      `2"7#\ @ ` 2 L   `"L , L  #\@ `   L  @ `2 @ 2  `@Zƒ  CSCOPE_DIRS :㿐@|!8 "T @}U     (T!" x`' @~Ζ @  t x@~– 2$ t-  t x'(T!$(T`@|s'# @!@>aH 2J   ` `thT >"hT@yА %s/%scscope.out8 @|`x 2 `x@ @gcXy @@< q `t,  @X  @Z* a <  2"$@X@W @Z E @ݒ / .@`@| @L`8  4 @Y /  $ @{$ $ @. @  $" $$ @ @>   @y; cscope.tpath%s:8`˜!(@W@W Q@x` &`, @Y \  @Wd `,@r @Zڒ  G @qC @q`, *@ `,:2`J` 2`J@  @@Ld  #&`(`, a(@?X "! &!(@?Q   @#` &`, @LG  &`(`,  "@`,  @x&`,pipevforkcd '%s' && exec cscope -dl -f %s/bin/shsh-cexecl: %swr㷈?''''D'H'L@= @8耢 D@Y @DH?"`  0DD@Y ?"@q`?"@qZ耢?"@qT쀢?@ @qN@x @u @r @qD@qBH L(@Vݐ–cHP @d#@D”X@Z @y @q& @q$Hch"$@F HH"` ’cp @F"H"`310|No cscope connections running%d%s 278|No matches for query㿐 ` 2 @Ðh@X     @Kx $$  @Kp , % % 2$ " $$@ ~   L  P` !`?` '+ a@F+ @p @?  @w@1>` 2  2  Ð@X6 R $ ``|! a @.M <   @. 3@2 $$`2@$`" $@@$ $`2@$`" $@@` "  "` L"  P"`" "` "  @w[  @wV sgdct efi311|%s: unknown search type: use one of %s㿘`SN@N@ "` "`N@ FN`  A&J    &L`"LN@@2L 2N`@Ė `  * *  !X@*`:`@HԐ`@W n `L  "  " L  "@cY ) L  % L  "#\  `  H*@  `  !@ `     2  @y @J2`#  @W= @.&& & *`& @y@ *` . cscope: %d lines%1[ ]%s: "%s" x@ '*@` @W`@( Ēc@  ??'`@(  @֐ '``? "`@?``@  "@ 2`*@' #"   "   @y\@  @ucЪ 値  Z耢 U`"T@yC@m܀ 2  Đ@)C؀   .@`@`@In  ; ( $ @xj / *@  ' @x]`@$  $  $ $  @xN$  $$ &"@&  &??_'@  @V?  ` `   "b` @Wx @  8`( ""'%$@T@S 2 &@x'`   '@ 2'㿘@"%s doesn't match any cscope command Command: %s (%s) Usage: %s cscope commands: %*s: %s 㿘`N@ `@ 2 Ɛ`@@\#  `h@U Ɛ@P` `@K` `3 `@?   2 㿘@@  312|%d: no such cscope session㿐 `` ``@ 2@`2 `Ɣ@U{ * ` "` @:` "`@:`@ @`"``"``@"@`, "`(@t`( @t@tÐ 1㿘   " #Ɛb "    No cscope connections. %2d %s (process %lu) 㿘   Ɛ@cP0  %  @h ` 㿈 2$@L# 2` ' #\ '' @s ` @.6 0  "& & L & P@yB P 㿘@w ` @*    2 㿘``? "`@=``@  "@>2`2` % `? "`@=` >` @`">``? "`@=` ` @`" 2` 㿐  2 `|`  @6[ 0&  `Q`d`l  2 ̖  2 `d& L@K " L  8& L buffersconnectionsscreenstags㿘`t `c" `s`b"  >`  `t", 8` 4ǐ @Ob耢 2/` @@0 'ǐ @Ob 2"` # ǐ @Oےc 2` @ ǐ @OΒc 2` @+w`  @5ؔ 123|No cut buffers to displaydefault buffer㿘 a@ 2  a 2 ȐX@Sْ 0\!@ "( # c\ 2  @@]  (T`D  @F~  2 (T`8 2  !@ "' # c\   @@4  (T`  @FU  2 (T` 2  ! Ȑ@x ********** %s%s (line mode) (character mode) 㿘Ȁ"@``*` *  !X@@D` "X"h@ܐ``3% & ` *` *  !X@@Dq@ hT   @E   (T` ޴@͒2 㿘`x  "`t0       @8 7  @@8 . `t @B%`@s`!@`|@A a 2 `|!,@9;  $ ($$ 㿐 @o = @ `|2 @9 @ @pp 0# "` ""`   `2 L"`L P"P֒ "`("`$$ &$&  %ld 㿐  2 ``  @4Q 0@ @I   `d'@ b8 㿘  2 `x`  @4/ 00 ) %`t@ @v 2`!  `@Ao@q``?#? @`6`&`   h @r L@T  piperfdopenvfork-cexecl: %sfilterforkwparent-writerp'L'T'`'D'P'X"'ܐ "D 3@` ? ''''\  '@ D@耢 D @?cȀ  'D@QĒ @(?D@Q ?"@j ?@j`@7  쀢?"@i쀢?: @i؀?"@ @ @ ?"@i?@i@i@iD d` D\ * * `8@Dc\@; / D d  D\ * * `8@Dc\D d  D\ * * `8@Dc\ X@՘ D d` DD\ * * `8@c\Dɖ@Ru @r @i@i\`'@i|cDL@͚   'D\`\D "\L TT" "D  `X @*`X? 0$Dʒ @P @iE'@iCkD@i?@>Œ` 2 @q #`DcL#\P@5D @q@i)\ @kD  'cDP@o   'D\ "\D @~   '܀`T\TD L P   L PD  'T` D@GD DT@?"@D `X *`X\  Dd @ DX@= 2 ܀2 filter read㿐   @ s 2` @0 2`  (T`  @C  2`, (T`"`,` @ː@P- @5 㿘`|2@ 㿘@ 124|The %s command can't be used as part of a global or v commandppp  2 $`  @1ܔ 0I@ ` Ȑ@O > `x "` `t@ "  "  #\ ` 2 ` \|   `  @1 02   \ 2 *  *   ꀢ \ " * @   2$ @1~  @2 L Đ #\   @ؚ " Lٰ #\"   @̚ 2ϰ  &  L P '' '@NƔ 2  @B\ `<$`<$`@`t@$ " '̒  '@n*  $` @OP  ؒ  $`H@q;$`L `P$`D  ,`P `| $@`|"  "`|  |$` `l`d@z d( (T`2@  @A   (T`@`"``"``@"@@n|`@nzU@pl  d @DX؀  ؘ    ??ܐ @h    0 "/` `@"*``@@!`@ @ $  @A   @Nɔ " $ $ $`@$ `<@2`@$`<"$`@`@(@p  㿘``@oC2  [  @N U  |"Q P G<<B  : @ `2`? $ -$ $<2 ?@%$ @ $@$` @"@@mݐ@AW  $` `$` $ $@$`2" $@$2 $D2 P 㿘 @A5$< 2&`$$ $  $ $    "@w $  @N+   @&+   㿘 2$$ @@ @9@ w 2  , " @mw  @mq@' 2 @mj& 㿘`= @'M/etc/vi.exrcNEXINITEXINITHOME%s/%s.nexrc.exrcΠ   @~  2  @Ɛ 2   |`"$Γ$&2 ΢ @o " @pU @ H  @oq " @pD @ 7 @oa "5 L 0΢8 Θ $@K @,  "    Δ $@Kp @  2  @` 2[   |`"$-$&2O ! "!! *` * 8`? ;΢ 8 @ "%   8 ΢  @՘ 2 8@<@ @ "    |`"$$&  X#\   5  @-w@o@-@㿘 `| ` @?В 2`| @Lڔ 3  $`|" `|$`|$ ` $ $ `2 $ @q_ $  `$ $ @o\@qO $    $ $  125|%s/%s: not sourced: not owned by you or root126|%s/%s: not sourced: not owned by you127|%s/%s: not sourced: writeable by a user other than the owner128|%s: not sourced: not owned by you or root129|%s: not sourced: not owned by you130|%s: not sourced: writeable by a user other than the owner㻐@J*  @` "` `" ``  `?`   w @Q@ / ?`@W$ 7@Q`  ` ϔА @L ϔ @K -   ` `thT >"hT@kZ`  ` Hx @K֖ ϔ @KΖ    ` `thT >"hT@k+ 131|No following lines to join.?!㿈 2 `d`  @- 05@B  АP@K )   "'(T!"  x' @o! `|   t x@o! "  & t t x'(T!&(T`| "`d`l &`l`d`l@2`d`&`l`d `l   쀢`   "(T t(T x >  &(T t x@oq "а & t t x'(T! &(T @o_ L `|!I쀥  쀢 ?J 쀢 9'`0'J "쀢 "(J`)#А!p@ ",@,`` ,@` ` J'` 'J "쀢 "쀢 @lȐ@ @J?@  $@?"$P " ?"$P  @@쀢 ]&`l`d$L`d`l @@x ?$@@Au  ` `thT >"hT@i  ` `thT >"hT@i`d h`l`" @$h132|No input map entries133|No command map entries134|The %s character may not be remapped㿈`|!  `x  "`t0@m  2 `""@J1  @ @j #:#\ @ ` 2    `2 '`  ` #\ #d#`@ku " Z ( `t KI `27`t  23`t ` 'S 'R  @;  "  " `t2`t р` "*` *  !X@@:@I   ` #\#`#d@k 135|"%s" isn't currently mapped㿘`t ``|!@ @k 2`t  @@J̒  136|Mark names must be a single character㿘  2 `t`  @+L 0 `   @H`d(@IX  .exrc137|%s exists, not written; use ! to override%swabbreviate map map! 138|New exrc file: %s8`x  "`t0  "ؐ@@8]`|@i`|! @F Ґ] &@FҔ! RҒc@6 ! "@aaE @lQ 9! ` @6"Ҕ0@lD  2,! ` @2(! Ҕ8@l7  2! ` @2! @Z@ 2! ` @2! @.5  "Ґ@@J   "@.%""Ґ @I X    `  @* 0?`d `h ?`l'`p'''??''' ؐ ?G Ƞ `T /'' @^<   & P"  & Lť139|Destination line is inside move rangex 2 `d`  @*1 0`h'`l'`p'`T@ '쀢@ Ӑ@H=    8`T   '"  8    . @@ 2   "'(T!"  x' @lB! Р耢   t x@l6! "ư & t t x'(T!&(T耦@"@G` &@ @=B܀ 䀢   @l䀢 ܠ@iȐܐ @= ` 8 `  '" "&  2 @= wŐG A @<܀ d䀢   @kʔ䀢 Xܠ@iܔ @= K`` 8 "   '" "&  2  @=? 1Đ ` `thT >"hT@fɐ$L`$P 8 "l  '"   @@ 2 l $l140|The open command requires that the open option be set141|The open command is not yet implemented㿘" " "" *` * 8` 2ԐH@G  306|Vi was not loaded with a Perl interpreter㿘Ր @F  142|Preservation of this file not possible143|File preserved㿐  2 X`  @( 0$ @ Րp@Fɒ  @^ݐ 2 @> 2 @_.  2 Ր@F  㿘`t@5ސ`|@5Q a 2 @, "  2`|a  $ @,  $ ($$㿘`|$`d@8`l  `l $ L`p$ P㿘`|"`d@%`l  `l $ L`p$ P㿘`|`d@`l  `l $ L`p$ P%6ld TOOBIG x  2 `  @( 0VU Pզ"?c#!Հ"'䀦 c@D%''  @ 24  @;i܀ ܀  $@#  @ 2  (T`  @8  2 (T`2 " $㿘 'PP$@ 28  (T`  @8  $ (T`2' $ ֒`P @ "   (T`2   @8k   (T`2 Ր@Pc  [ynq]㿈" '" *` * 8`@" ֐!Ȓ'  @Q 2J @ @:Ƙ쀢 2A  ` @= 26 `  '&  @+ ^ 2$  (T`2   @8   (T`2 ֐!ؒ'  @  2 @ %c㿘", ""$"$ *` * 8`2$#Ā "#ĸ$#Ā " ## * * `8@@ 4`$2 @jd 8 }%@??y֢#` @x hT p  @7  2 8 (T`2e& 8:\??‧`V  , *  !X@@5 ,  * a] @@5`2 ? 8@@Y-??"*)# 8 @I#c @ hT   @7H  2? (T`2 &??ݤ2v@& 㿘$'L'P'T'Xd4`4$ @@Ld4$  #" @$d4J`3 @)㿘N@    4$4$(@@@$4* , :`$$4 ` N@  `@㿘 $4 4 h $$4 㿐  2  L`  @% 0  P'`|`'`Q `d @YĚ    $ L$ P㿘`| !@2 2 @$ `  $$"&$ !!%s ! r%s145|Only regular files and named pipes may be read146|%s: read lock was unavailable `x   "`t0'( @ @ !`#X`   #P 8*` * `2 `  #P " `  @%o 05 @d"   @)i  @) 2!   `x  2 `x2  `  @%> 0?` "`t@b`t, @ @ $` Ȕ $ `@`t`@$`@ `t`0ؒ`ܐ$`2$@&$$ (€  `  @$ 0$ &$`t  @#\`d 2 ` @&`$ & L& P@gQ P  J  2 `x 7  "`t2`t@ct!   ` ! @gk "  @b8` "  ?#? @2   ` 3   蜟@ ؐ@1 `t@ @$ 0Nؒ`@ T @eQ  ؐ@Cے ; < @  @" T @'ؐ @B 0'T   @1Ș  ؔ  @Bo`d@! $ `d & L``d & L 147|Reading...148|%s: %lu lines, %lu characters㿐 "   0@g d 2, (T`,  @4  ` (T` `2 ,   hh , @8< >@" ͐ @1@'l ,؀ 2'`/ @G^ِ @A    ` `thT >"hT@aK  ؐ@C @'8 `hh  㿘@=㿐``x` !`t@  @Į    $ &$&  㿘`|     "  ` "  `  @#o 0`X@149|No background screens to display 㿘     ڐ@Am 0I     @d ` 8@ ?@ ڢ b8    ڒb@   T   @4  2  (T`єT   @3   (T`ڐؒb8 150|The script command is only available in vi mode㿘$  ڐ@A   `x    @@ tcgetattrptyforkTERMemacsTERMCAPemacs:EMACSt-iexecl: %s㿘 3@O 2 @` ? @@Δ  $ & $  \$ $  @c?2 `ېH T d ? $ `$ d`h @c?ې H  @ ?ېX@@  @||?$ 0bې`@@  ?" @X ?b @Xxې h`p@r̔ ?ې x`@rÔ ? ې `@r ?@aR ~@|R  @cA`a@X  @  @  @ @X #d`" #\#\ * * `8@@ / 2 ۖ @ΐې@A| @a @  2  $@ @&$T  "TselectError: timed outError: shell: EOFshellh    ????'' Й2+ @  * "@      @   $@? $f$@$"  @Xe?  @۔@?ג 0dPؤ)  'S 'R  @1   2 @7̀ C̐ @5Ԙ$ ;  * $@@Y@a"''    @E " ?0 0۔@? 0@6ʒ̀  $@̐ @5 @ @-151|No command to execute x@6 2   @4쀢 2ܰ  @* 7耢 5      (T!  ' @ca䀢  x   t@cT x " $ t t x'(T!$(T@Yh @4=܀ ܀ {  @ܐ   ܔ@> f "@  ''  @Wo@ ` ܒb@We   `  "bؐ@>̒ D A   `"hT`t@hT >&hT`x  `t@b`x "; &`t`t`x'hT!&hT  @bД䀢 % @@X@5g 2    ` `t@hT >"hT@]p Ш  ????'' @ $"  2`* `(  "  ` 4 2$   @? "'  ې@>4  '@$" `2* @ :@ `"@  2 2$ `@5[̀ 2̰     "'(T!"  x'Ȑ @b0$  #  t x@b$$ " $ t t x'(T!$(T  `@Vc$?  @ ۔ؐ@=ђ } (  'S 'R  @/   2 ̦$ '̖ @3ј V  * C$@Ā Ā %a  ????''`Й2+ @  * "@ `   @/ @W̔@2 +  '̐ @3  ̀& L& P& P@U    ` `thT >"hT@\㿘  @\@\ $  @=0   @W $ *@ @I   5 1 . K2!K )? K"? "" J@K `J@2" KJ@ `?Ԕ  2" script-shell㿘` 2d  @*@$d@ ?" @U) ?"@U#ߔ @  @\* @\($`   "(T@䠀 "(T 2(T߁"(Tttypqrs0123456789abcdef㿘@Q! ? J!`T!Y"+ aMa F-Y"  p,,  @:9   t "`/:?@,@[V!@@ @: ?&&@@@,C   `g@_& @TL 2  M 2   "b?㿘`x 2` @Ke   `t @H2 " %s -i㻘 3@K$ 1  #dߚ#`  #\ * * `8@#\  @:$ h  $3    @  h $@$$ vfork-cexecl: %s㿘'D  3D'L@Jߔ D d  (€  D`  @ 0u(\  D$`"$ D``D[DW`zD@` DO D@; L D cd " c\c\`* * `8@@U / D cd  Dc\`* * `8@#\D cd " c\c\`* * `8@ L@ D #d` D#\ * * `8@c\D@< @\6 L@ waitpid%.*s%s: received signal: %s%s ...; core dumped%.*s%s: exited with status %d㿈# b $b@Y ?  N L  I`N #N " "@@g@]@_ `c ` `#@#H #\#P#H#` @:ߘ \   ` `thT >N"hT@Z<M `2J :` E2D N #N " "@@@]Vc` `#@#H : #\@:    ` `thT > "hT@Y  @:    p`P@    hP @0 hP8Filesize limit exceededCputime limit exceededWindow size changesVirtual timer expiredUser defined signal 2User defined signal 1Urgent I/O conditionStopped (tty output)Stopped (tty input)SuspendedTrace/BPT trapTerminatedBad system callSuspended (signal)Segmentation faultQuitProfiling timer expiredBroken pipeKilledIOT trapI/O possibleInterruptInformation requestIllegal instructionHangupFloating point exceptionEMT trapContinuedChild exitedBus errorAlarm clockAbort trapUnknown signal: %d㿘"8 @  ``1 !@7 (㿘@ 㿘@  152|shiftwidth option set to 0㿈`    @E 0k c| " ctct`*` * 8` H@9N V  dlŘ  N t @'J " ctct`*` * 8 `'J` >" c| <" c|` ` "'(T!"  x' @]I! d   t x@]=!  $ t t x'(T!$(Tdl  @.O쀢 `쀢 = @. M  # &  cĀ  c`* * `8@ c  *`  8*  @^0&`@*M   $ ``L"  ` ` "(T t(T >$(T x   t@\ɔ x " $ t t x'(T! $(T@\ ~ c, cĀ`  c`* * `8@& c& cĀ  *`@ *` 8    , ?@@ZB"" "@/" ` `` `thT >3"hT@W; `L2  `P$ `P%@@ "@$`P %` `$`L$`P@\r`P` `` `thT >"hT  @Wqd `pl`" @$`p%s8`t  @5 F@Z AȀ    @  2"b@W`  @7ϔ `@P*2 ,@@PG@P  ș>`̀@ ȕ>`̀  "b@WP@8    걚 㿐`|!2  @&  2  h€    2  @\  㿈`x `t`@L@ `L@ " "2L@@hdc\  ``\2.  P . 2 @L` \`2 @,`  @,` L@  @ꀢ \"`,L $ 2$ @ % @  Đ #\   @W 2    #\  @H  #\ ؘ @< Ȁ 2  & L@` @@`%@"` "& @VM& & L``@2@``Ϣ*`:   :  ~` L@ 2*`   ` hT!"`x' @Zٔ  `t@Z͔`x " $`t`t`x'hT!$hTL ' ~L` \?` ~,` 827 @"D `"< *` * 8`2) @ "< 2# @ 2 @"D ""<"< *` * 8`2  @ " @  @X>`   @,` L@  @ \"`'&  @U@Uv &  @6%   ` `thT >"hT@U @X   ` `thT >"hT@Uo@㿐 ؀2$ @͔ !  @  ܐ #\   @' "`x `x  `t@@b 㿐 2$ @ ! @  Đ #\   @ "`x `x  `t@@6 153|Count overflow155|Regular expression specified; r flag meaningless156|The #, l and p flags may not be combined with the c flag in vi mode169|Confirm change? [n]157|No match found㾈 'L  'P`  @A 0<! L ' P '!| *` * 8`!| L. . L ''`'J@ y @?* : `i}#*` €`\ b&`\`\?^&`\m5 LL&@t  "&LJ 'L "2`l֔ @5   &`l&`d@, 0L@,B`l *LѰ  $' $`?`.   ?'' `?.  '  ' $@  'PL 'LJ 2 @LJ`2 ` 2 $ " $`  @ 0$ "`d `  "`di`d `l'' '''' L@) C  C    T!"x/''   "TtT >&Tx t@Xx "= &ttx'T! &T@X ZL@V<'L ' '   L   ? ?(P@ @MM  Ӓ `'8` $@24 (,@2/     !*!@' @SW  @S ' @4  " 'L? *@  ' $',@''̀'''$ 4 ' 'Ԑ& P& L@̒  bP@8 @K ؐ @& o ")  (k @(^f иȐd 2[  2T  @( I  @/䀢 q"E  y"H(   B    &L@ $@  2!a ! ' @R  @R ' @3X  )L@,@UB,@T' 'hT !"hT& L  @ B  $ & P2)@ & @ B 4  2! !   ' @Rg  @R ' @3   L@$@T$ L'@ @֚ 2 ',` $ú  ` * @  !*!@' @R#  @Ra ' @2Δ  "'L@T@@'  ! @  / "  @)2 b   \`  & \ $@ " '&  @)r I L@' A   "TtT >&Tx t@Vx "R &ttx'T! &T@V oL@TQ 'L' "!@' @Q  @QӐ ' @2@  "J'L@T*@' `   L `  )  !*!@' @QZ  @Q ' @2  "'L@S@@'   @  / "  @(j    \`  & \ & " ' @(   X `& X & `` 2' "!'''̀`'ԐЖk$Жb" ЖY쀢`8  (T`  @$M   (T`  L@ 2& P P & P@Uϔ P  `    ` @&`P@  $@ h@1L   !   ``thT >"hT@15   @   9'@P @P<<<<<<<<<<<<<<<<<<<<<<<<`<<<<<<<d<t<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<l<<<<<<<<<<<Н㿐\'H'L T ! "!! *` * 8`2 ! "! ! "!! *` * 8`2`!䀢 "!`!䀊 "!! *` * 8`L  LH#\ @ `    `""`  $@ @\ $*@&$  $ @ @\ $ *@&$S  HL@y 2e ` HL@ L@^ 2T   @O& L'L@Oa  & @0  H@QLL*@    ` H`thT >"hT@Od `" 'HH@P  2 @ `$ &$ $ &$ [[:<:]][[:>:]]㿐 @` L ["l"D \ *f ."e"Dv ~"H"Dp`(m L < [ *' ."&"D_"""D ~ >"  V""DR O " "<"< *` * 8` 2A ' "D " "<"< *` * 8` 2/ +  ""<"< *` * 8`2   "   "D " "<"< *` * 8` 2   2~L  &&    T!"x' @S\   t@SQx 2&tȰ tx'T!&T`@ ` ~ \L [  \ * .""D. ~"q"D.`(. L < [ *F ."E"DZ."A"D ~ >Q."#"DM. . . . . . .  . . . . . . .` ""<"< *` * 8`2R.6 "3 K."D ""<"< *` * 8`2. " . 3. /. ""<"< *` * 8`2  . ". @Pe   "D " "<"< *` * 8` 2 . .Q &&@& ^.[]$*㿐 &   , T!"x ' @Rk  @ t@R`x 2&tY tx'T!&T@  J? / ? ?  J?`$ ?   N / ? ^ ?N ^,@ `?  ' \N \2 NN  / ?2N  ?@ؐ耢 ".?.   $.&&@& ([ ]|/\*([^*]|\*/)*\*/)*\^.[]$*+?()|{}㿐  @L@ "?` &* @* $@   *     ` hT!"`x ' @Qʔ @ `t@Q`x 2$`t9 `t`x'hT!$hT@ ^. `@Oj  ) \L@` @O]   @Y! " @.  @. ?`@OJ   $. &&@& RE error: %s㿘@5 @L  @-6 0 @5 @-+@L㿘'P 'L'TP'H N L & \ ” `"D ""<"< *` * 8`/   )*  `L?ڀ`O ! *` €"D  "< *` * 8`"<   *: ?Ц* @ ?@ @  {@ `?2`` ?t `` H"@3 @ `   'R  @ ' "    c\0  c\0c\ ` `  H c\ ` ` "*@  `@M!*! @K@K  @,l M-`      ` 'S 'R  @#   &   @2  ` & @Kx*` @K*` &  @,#  耢 2 & Z  * "  +& ) "    0  0#\ ` `   H #\ ` `  "*@  `@L!*! @K+@Kh  @+Ք -2LL "P"T"̝X#\   9  @ @N @ @   > $158|No previous tag entered㿘`x . 6` "`t@J`t@~@ $` @+2  #Ѐ " ## * * `8@ "`@M`(``*` 2 `@+  @K`@ " @   @ j$$  @ , b% % 2$ " $$   L  P`  a2`| `|a !@ >  @Ð 5@2 $$`2@$`" $@@$$`2@$`" $@ $@g "  "` L"  P"`" "` "   @J @I@ 282|Already at the last tag of this group㿘 2  @ &  @ 2 `|@*c   @V "   $ B `$ @ `  255|Already at the first tag of this group㿘 2  @x &   @ 2 `|@*%   @ "   $  `$ @`  㿘` `@ &`` @ @T   ` @Y   $ >($$ 㿐` `@  &` @G G @,    @ @G09` @@$ @* @G~ 0( "` "`"`   `2``  "`("`$䠐 >" "$@ $$$ 159|Less than %s entries on the tags stack; use :display t[ags]160|No file %s on the tags stack to return to; use :display t[ags]㿐 @@2`x @ b   "`t0ST  @jJ@ $L @4;@)0 9 @KӐ@@ /   @~'  @K 22 @X@*N  2`|  @I`|@ 㿘 @  ``|@  @,  㿘@   @  & L & P@1  2)    "   #`  `3 @,  "$ (&$@@  2@@@2 @ 292|Display too small.%2d ... %*.*s %*.*s*%s%.*s 㿘 2 8 @Ɣ 0 "@(w 0xd @] ;9753/@a`!` 2 `@J   ޖ  Д ֖ 2ϒa@"` 8?• @J֐  8݀ 8 @!!! 㬐㩒@@2 (T`  @̖   (T`2 㿈 @G`@ e``(@ 2[ `"``" "`@2 ""@"` ݐ" "@2 $"@$ @@ "@"쀢 " "` "$     @ $  @'  㿘@Fѐ  2` @'  `$ ` @$` $ $ @$  $ &  㿘`  ` !@F  @'Z  @II $ $ $ `  $ & 㿘`  ,` -` ``$ @F  @'2  @I!`` ($ ` "&`   $ & 㿘@` `"``" `@"@@F}`@F{ 㿘`` @&` "`@&`"@@Fb `2@` @`$ "``@@"@@FO 164|%s: the tag's line number is past the end of the file165|The tags stack is empty166|%s: search pattern not found㿘`  ` 0 @& 0@' 0@G=㿘  N@ @  /`&@`()@@EҐ   @& $ @EȐ` $  @&w   @E @Ha *@, $ $  "@$ @``ʲ` 㿘 Q@ 6 `  @E 㿈#\@ `@&'@N 1#  ' '#\@E @{ (  " #\ @E "   Q 0 2 & & L & P@J[ P 162|%s: tag not found%s㿘@H @ג`! K & &   & `& @GВ ` @J  `   ,`@` 2)& H@'   `' ! `  2 @` ` `$@&  ` ,`@`2 `@E   163|%s: corrupted tag in %smunmapclose  'P@#G  " ' @H/  #\    @G֘  " @=' 0P@ @P@( 'M  `'J` @"J@  *@ '%`"`'@GՐ``@Ƞ ``2P P@G 2>PP@*y' @*t! @%     t@T >"T@Db    ` `thT >"hT@DM@ <@P.@`@`@  , ( $ @F / *@  ' @F   $ $ $ @F$ $ $ &"@G& @G  @$ @< @$  %s/%s8'N /"@"U `@zF / ,@`$@"l@"A  /`@G&' /,@㿘&2  : @L  @3 2&2  : @L  㿘@@ "@? @0@@N@ `뀦@ J(88   ?J` @ : JJ@  @ *J  @  J@` ` 2?302|Vi was not loaded with a Tcl interpreter㿘x@#ڒ  8@  8$   і "m @$ $`2@&`" &@ L $  T    Q* !`* L#!`  L  @s| 2C @e ؐ @K 3?`  #0*` €C @&?      @G " $ ?`"*` €0&@쀊 䀎   ` @J?`\‎   @ @J?`.@ &`"` @"@ذ  5 Ѐ  $` @r 2 @B   @r  @ז$`$ @@2`&@"i&`  @2   @~2| {䀎+  @ J@  J "` "`@  $  !`*  *`?`" @ܐ e) `"&"  *" 01 @''  @Fϔ "G '  @D  '' @ |€ $ $  @@ 2( |@C| €@B䀎@ #\ `  Ґ  * `$  X|T8D@@@@@%c%6lu %.*s㿘@i#`" """ *` * 8`  `@i#h"`#p@i`@:!`㿘#Ā " ## * * `8@#| " #t#t * * `8@` ` @ `L 2`@GC$@ *L@G9$@  @G3$@G-$$@  `@E` 2&` &` &` ``* `&`    `?`* `&` 㿐`L`P'' '@ ٖ  , ` X 2 4  . X& 4 4   @ 2   & 4@    & 4@A $`L$`PTo see the list of vi commands, enter ":viusage" To see the list of ex commands, enter ":exusage" For an ex command usage statement enter ":exusage [cmd]" For a vi key usage statement enter ":viusage [key]" To exit, enter ":q!" 㿘Òbܿcܻc@cܷܳc The %.*s command is unknown Command: %s Usage: %s ^D%*s: %s 㿀`x S `t@c\  ` `H*  + #@`" @@@` 2`@  "``!2`  @ b*  *@`9`80g!`3 X"@ @[@ 2 ```# X0Q#6@2`( x!$ [/@ @ ]*  /@` //@ ``*  / * +`  @`` @  (T`  @  c (T`c0@@ The %s key has no current meaning Key:%s%s Usage: %s %s 㿘`x e `t `" `  @ 0 `~4,`[`]`~ #`~B$ "## *` * 8`|B |"PB#x.`@` `` #0*` *  !X@@fQ ` J cX #p#xT? B#x #| !.`$ "## *` * 8` bP.` bP.`` /#``~4  (T`  @T  Հ`~ (T`Ѐ`~ @@ 㿘\  @Aې.`@*`# @& & `& d& l& h`& p |!6 |& t & x$ x t( "`"@ x t(" x"@㿘  `,"" `0  `,@Cy`0 "2 $`,`,`? &`@V@  &@`  ⨀ 2  $6` ` 2 ,2&2&   Ť167|%d more files to edit㿘`2$  0 , @"  ("  " & 0 `@ 2` ("@ :@  㿘 (€  "(\$   "`" " "  * * `8@!`  & 4!X * * `8@!X$& 8 ? &$ 168|Buffer %s is empty144|%s: expanded into too many file names283|The %s command requires the ex terminal interface272|That form of %s requires the ex terminal interface274|Command failed, no file read in yet.173|The %s command requires that a file have already been read in171|No previous buffer to execute172|No previous regular expression230|This screen may not be suspended290|The %s command is not supported when the secure edit option is set284|That form of %s is not supported when the secure edit option is set174|Usage: %s㿘 C ē. €0`x@U 02%!`2H @ 0P@ 0@ے @P`xVersion 1.79 (10/23/96) The CSRG, University of California, Berkeley.㿘@  175|The visual command requires that the open option be set%luz%c%lu%luz%c 㾐" " "" *` * 8` 2 `dX@   " & L`| (b  - @  ^  ( +  . L P#  "`@A L ` 72``|   L`X@Y!  L@Q! 8  @6 `|" @d"4$b2$ !  @+ $   @+ $`2$@&$$@  `& "@{' 2 2 2  ؾa  &$ 㿘@j 2  @ Ғ 2 g&`x㿘@U  2 @  2 `| aӒ `  $$"&$ 㿘@4 㿘  2 X`   0! @   2 @  2 `| a `  $$"&$ ! 㿈  2 `|`  l 0!  `x `t@L  "  " ^2]`dL !2Y`d#X "#P#P *` * 8`2`      `  5 0L  "  " L `  " 0@>  2 $ &$`t `d#\`l% 2 $ @2 ̒a `d `l@)` "``x L >L  > L`L  "  " L `l`dP @> 2I `x 8  4@   &`d&`l 20 @?`&`d&`l@ ' @?&`l&`d` @|쀢 2 `l쀢 8&`l̐  2& L /tmp㿘`,`0`0'   $`4$  @ "@  @9k@9i $`0@쩒 52  @ ג   @ `# c@쏐 `0@  & @9? @ʔ  `0&`4& `02`4$`0"$`4%s/vi.XXXXXX237|Unable to create temporary file238|Warning: %s is not a regular file%s239|%s already locked, session is read-only` `   ?#ߐ @6`@5  `6` @ p \ 2 `X @z  ? $`T,`X$`H$`$`x@t  `t f` 2M` @(f 2F`!xx!@`  !p * * `8@!p  @C$@;?@\C!? P@0 ?" `@10"@1``` 6`@d  &` ` 2` @[ &`` "@8~ @  @?`` $` 6`@R`D-  @ cB + gB + 3`   8 " < `X x|  ,`X$`<$`@$`D, x @  ??  ?/''T2   '`@0P `L'@ $`L @ ` `X' ,`X  ! @؀  $`᠐@ڒ  @i 2}`@g 2w` "     "@  ``6` @ @ X``?# @6` ` @`H@ "   0 `! 6`ᨨ @  $@`  `@    )  @& @ )  @& @&  $@@& $ @&$2 "` @7{&`` " `X@>@7r` &` `X @"`L@>`L`L "`@7e$`L`  @@7[`P %s/%s㻘`2Lf& / .L / . L / @`?P&@ 2"Ȑ H&   " * * `8@" - !  L : 2 ?:L,$@#8#,@d 2L ` @6ɐ  @x   @9g@6`&`& -c option㿈  & L& P $   `2 $@ L q L 2 & L& P #bx@9 [  \I$ $ @ L Q L 1 ; ` `& L`&$& P!l "!d!d *` * 8`  & L  @ & L  L  @ `쀢  & L& P P쀢@8  L& P@;O P P L ''& T '@9240|%s: remove241|%s: close242|%s: remove243|%s: remove㿘`" @? &@ 0"0  L $  P`$ `/4  ",`@=  @ @6   $  0@ "4"`  0@"@  @6@6& ` `"@  @ƒ @  C&@@t@R`X` 2`H`L " `P@=W `Lฐ@ `P " `H@=I `P@ `H?"`T@.`T?"`L@.`L "`P@5`P @5@5 244|Read-only file, not written; use ! to override245|Read-only file, not written246|%s exists, not written; use ! to override247|%s exists, not written248|Partial file, not written; use ! to override249|Partial file, not written250|%s: file modified more recently than this copy; use ! to override251|%s: file modified more recently than this copy252|%s: write lock was unavailableaw254|%s: WARNING: FILE TRUNCATED256|%s: new file: %lu lines, %lu characters315|%s: appended: %lu lines, %lu characters257|%s: %lu lines, %lu characters   @M     ` "쀊 """ *` * 8`    D#PA# B$ " $$ *` * 8` 3`  @.   ##ؐk  `@  # 0@/ 2 @ $ `   X  <@ @@ D@  P -   &"  @$   !0 !( * * `8@@! " @!  `᠒ @! 0  @   А @ !@  `@ @- @ ''@  2 '@#\#`D`@n " X@D  ,X$<$@$D  2 @ {  ?  5  X ,X `@㿐 5 @Ŕ<0a(!X!@h HD@$@@G?8$? 8@4 8 !%@6ې@@ OH /@  N@ /2` 8?:`@  ..@.@.@@ <    ` `t@hT >"hT@3o 258|%s expanded into too many file names.%d259|%s: not a regular file260|%s: not owned by you261|%s: accessible by a user other than the owner?b'H! $" @ ?   " :H` 8#\    * N N  @6G͔ 2B   @@ג @+5      (T!?# '`*  2#  @7 @ x*  2 (  t t@7 x ހ$ t t? x# '(Ta$(T @L*`: `% `/L  %" *"  *L    % d,@,`,`@: p ,@4 /,2 @$@9#`@I 4@ ?@p?  `"@@ x @@̐ "*<  @|@  6  @ Q$`@! @UВ! @@+@9: @+? 1 ?#@@+) 4"H@* H@* `݀   ` `t@hT >"hT@1+ @*ې`@9d@*Ԑ`᠐@ `   ` `t@hT >"hT@1ʐ 㿐  @  "  yJ@#$! &$ <J`#2j& L  @ 0^ ,/*J` *&$!&$ ( J@ *J` /`?' '  @\ 032& L/J@ /+J` /'$!&$'' ( J@ /J` /`?' '  @) 262|File modified since last complete write; write or use ! to override263|File modified since last complete write; write or use :edit! to override㿘 2 X7 1!$ "!! *` * 8``  `@   `  ! !P@k  @B264|File modified since last complete write; write or use ! to override㿘  X   ` @=  @265|File is a temporary; exit will discard modifications㿘 "   `@"  4  `2  P@  266|File readonly, modifications not auto-written㿘  `X !$ " !! *` * 8` 2"  """ *` * 8`    @Ӓ    / 㿘 `@03` & @ &  @ 㿘"8 " "0"0 *` * 8`   @  ?2 1 @ے 1 &"@Մ  " #@? ` 177|Empty file㿐@`` @     @m  ` ` @i`  &`&``&`` .` 㿐`` ``"*` 056`2@ &@ @`  @?&`$&@` `&`@i "` &`&`&`&` @.``?@`  &``&` .`@0 㿘` 2 ` 2  ` "  㿘 "`  " " 2  ` "  㿘``; !*` €@' &@ `@(`  @ '&@` ` @i`  &`&`` &``  ?@    &` &`?`&` .`@0< 1L01L01㿘 "`  " " 2  ` "  079|No non-printable character found㿘  b0@W= @ @N  @J  @F  @B #Z!Z!b @߰,RbS R@:  ,R ` *  c\J`    ,p  c\ @J`2 ,p p   8@  㿐 h " Z!Ԙ` !  2" 2   Zb!ԗ*` * `# #b㿘  ] *` , !X@   - ,@`  㿘@ 㿐bԀ /b`. (8b``@" b"'/``@b" bxbx`. (8` 1@ `@#\H#\/`_ #\   2b ^/`@ ?/`I b"bb`(( 8! \Z6  \/`/`   8 8  (@6`?'` \ xZ/`/`  @0@ /@@`/'`)㿐Z"Z/aԘ @͖   㿘 a (aaa a`2 a 8 aa ("&$aa@ @ `@* @@ "aQ a .a*"@ "a* + " #H*` @(-* $aaa*`" a* @0$a `"$ @$`$ `$ ` $ `$ `$ ``$ ,  'S   'R  $  $ , ՠ  㿘`  ` !  `@!!! "@@ `@ @@!!*`" !* $!*"@ `*` # -` $ @, ` 'S   'R  :$  $ ,  0@# `$ `$ ` $ `$ `$ `$  h`   @2p `A6T "xη 2b x1 2Y `?`! *` €  @RF   hT "hTg 28 A25 * "@*` ` ` &@`&``&`` &` `&``&``&`? $$ $\ ` Yc\"W ` L`  ` 2H @ : I  #\ @. Ԁ 5 $ "$$ *` * 8`2`| y ` 2!! "!! "!! * @*`8 * *  _* *` *  Y* &c\ `  `2@* a@&@`&``&`` &` `&``&``&`? $$ $"  "\  2  a .` &`.`&`} * "@*`  @0Y `? "@`$$  $  # "## *` * 8` J F  @ xؔ  2     (T `"(T3&`     " ݘ  2&    Ԙ   * "@*`a    Ř  "       O ;<<(<(;;<(<㿘   "  @$&   @$276|Unexpected character event277|Unexpected end-of-file event279|Unexpected interrupt event280|Unexpected quit event281|Unexpected repaint event285|Unexpected string event286|Unexpected timeout event316|Unexpected resize event287|Unexpected write event㿘`?` .*`# €! @ ` @ # ` @+ @*CCCC(C8CHCCCXChCxC   """  ( (  㿐 !@*`.`" "**   '!@/ 2$! @/M $!   ` 㿐 '@ ` @ 2 `  @W  ' 㿈`K'H ` } H 2H$@"#` x |`      @`2@ `'? ;`H@" "@'H`H 2&` *&` H ?`  ? 2H H@ 2'2&  &`&` &`' `& 003|unable to delete line %lu㿐  'H   @ @ ђ  29 Ho  22 H@ H ''    HH@@    @($   ?$  X " X@"  X`, XH @ 004|unable to append to line %lu㿈  'L 붔 J L ?''   ? LL@  4  @*$    $  X " X@!ǐ X`, XL @`L@ N L@   2 L@B   005|unable to insert at line %lu㿈  'H X F H ??   ? HH@ a 1  @:$    $  X " X@!j X`, XH@ H@ H@   2 H @    006|unable to store line %lu㿈  'H  3 @ H ''?   ? HHp@    @"$  X " X@! X`, XH@] H @ 㿘  `   2  $@  x |`"   `?   `?007|unable to get last line㿀 `2` ꐔ G  &@$@"?  x |`" 6 ''`  ?   0@ &@ &@ / ,  ,  , $`$`$` $`$  | @  &@ 008|Error: unable to retrieve line %lu㿘@S 㿘$ 2&  @   "  2  @ 2    @009|Log file㿘 &`$&`,&`(&`&` &`0 "! @d &`  @  `X  .`X㿘` "` @&`` " @'f&` &`$&` &`,&`0&`( 㿘 X  , L",P "0 ",P @"0/usr/src/usr.bin/vi/build/../common/log.c㿈     @+ "& $   ,*  @"   ( ''  ''   ? (  $ $$ (`@̔ Ű 㿀 'H X " ,b ` , X  2X $ ,H Ԙ H`E !' '  29    (   @+ ", $  H*  @!   @! ( ''  ''   ? (  $ $$ (`@`! 㿈  X " ,; V  23 $ ,    @+E  "' $   *@  @![  ( ''  ''   ? (  $ $$ (`@!Y 010|Logging not being performed, undo not possible011|No changes to undo`  `X`  `( `Ȓ @ 0`@!z ,`X`( '' `(`$`(   ?`[#8*` €"`( @   `X `P,`X @ ޔ U B  d & dĒ @ Д  Ė 1  \ & \Ē @   Ė?    XĀ "`( `& X & `  @ ؐ''@  `(@& `X  ,`XUUpUV0UUpVtV012|Logging not being performed, undo not possible`  `X`X@ ~ `(  `x `@C!q ,`X`( ''`(`$`(   ?`S!*` € @ C  L@2 `X`( 2`( `XB  @ 3  L@"`(`( `X` ,`X3$`( @ "  L@2  X   X "  `& X & `  @ ؐ''@ 2 `X`(@&= `X  ,`XXdXX X X X XYL013|Logging not being performed, roll-forward not possible014|No changes to re-do`  `X  `(`$@ @i 0`@"K} ,`X`( '' `(`$`(   ?`^ *` €"`(`(`$`( @  `X `P,`XĒ @  Ė ?  \ & \ @u  1  d & dĒ @g  Ė    XĀ "`( `& X & `  @Pؐ''@D  `(@% `X  ,`XZ[[X[[X[Z\0015|%s/%d: log put error267|Log restarted㿘! @)_ @Ę   @ @ exnexnviewviewc:eFlRrSst:vw:only one -c command may be specified.only one of -r and -t may be specified.only one tag file may be specified.-s option is only applicable to ex.window=%s0(h # &(h(  #&(& &  & &   | & |& &  . p 0& 4& 0!,&!0&!,&!@&!D @ a` @ah  @ap @ax    @ "(T   @&(T     7%`80#D*` €!  "(&! %`(T ?!&(T  t r  rt "  t  ` "( 0@p?ƒ?c*  `  @   (T 2  @! `"  "@"` 2 & "`|& d "d ""` 2 & "`5&  f    6 ?Ȁ` )"@` 2"@`?"@@  L `!0@@&#''''''@    @/  (  @)  C  @#  G  @  "  "   * * `8@"4 ` " XX* * `8@"8   rZ  d& r  2 `@  ~ ` X* @*`8  2 "!   ` ?"d "d׌   ( "@% @"7   & " @ ` @'" $" (rd "d " 6$`2 @ 諒  褐 |$@   2  n  | `{d&  @ k ] [ $`!@~ @ ؟@ E B  2(d耢  2(d ?" `  "`") $`Ȑ @`ؐ  2$   @   @E`P`P`P`P`P`P`P_`P`P`P`P`P`P`P`P`P`P`P_``P`P`P`P`P`P`P`P`P`P`P`P`P`P`P_`P_`P`P`P`P`P`P_`P`P`P`P`P_```P`8`D%s%.*sex/vi: 㿘     @   @  @  @ @  @(T !@朗`( l !`0%#  8`@  @` "` " l 2 ---c$-s㿘)'!hpN+L +$L  @   '&@ !h `* `* `*8*@$5@ ֐  &@ - c**@˒ )` -2&`L   c@    &@ " @*   p * ** T t w2`J` "``@ " @ a` 2@ %s: %s 㿘!b@c@` ! b@#@@c"`8 㿘 `8`""`"@@  `82 017|Mark %s: not set018|Mark %s: the line was deleted019|Mark %s: cursor position no longer exists㿘``" '@   `#耢`*`#  `  ` "  2 ``  (*` *  !X@@  & &㿘``" '@C  %@    @ / 2 `8 "`8"  "`8  8 " "" $"  2     $ , $  , ,   8  *2㿐`  ` 0<@   8 "6  * ? `. &  2 ! F  2  q      8 "     &  2  020|Error: %s, %d: : %s%.*s㿐'P'T  'X` C `"@ ?  `7!,*` €$ / $$  8$*` * `$   T $T$$  8$*` * ` 0$  $@ a@ P aȪ   "a$   ` `t@hT >"hT@ , '    (T!' @# "%a x  t x@# "%a$ t t x'(T!$(T` c@ @!R @ ``@ <; 7L $   ` "* *  !X@*`:`t@5 ' L  "@@# 'n@0 "@@P^' X`2  b!$@@ @' D   ?  . 蔒 !`@쩖   ` `t@hT >"hT@3%aȁpqPq,qPp㿐! 0 "@$"    ` `thT >"hT@vhvXvHv8v(vv299|yanked298|shifted297|moved296|joined295|deleted294|changed293|addedvv301|lines300|line%lu 㿐$@#  & X# * * `8@# \  ,    t   ,"@0    "'(T!"  x' @"V" y"  t x@"J" m$ t t x'(T!$(T"ta     9 3" ; , , ` "@` ` @ ' @ @@А ,@ @ @Ð`@  $Ȧ , `h    ` `thT >"hT@317|%d files to edit021|new file022|name changed023|modified024|unmodified025|UNLOCKED026|readonly028|empty file027|line %lu of %lu [%ld%%]029|line %lu㿈  @ ` '  * (Ta  ' @! z   x  t@! x m$ t t x'(T!$(T  L@ , @  * @ *`!] '*:`e' @ ` *`* *  !X@:`\@`L@` @ :, ,$@' $ #@  `@   a@ @r@ :, ,$*@&$ `  ?# @2"a`a@@   ,, ,  X`aa@є@   a  ,, ,a@@  "쀊 " "" *` * 8`0  ,, ,b@@d   :, ,,쀢 |쀢 b@q@C" @eb .`@*`@*`@ @0 b@@Q@@Ԑ ,$'* 8@&M /   L /2 $@8  .$? ,?,?,?,$'Ӑ h    ` `thT >"hT@SLC_MESSAGESLANG%s%sVI_MESSAGE_CATALOG030|The file %s is not a message catalog㻀@Q / "#L  2 @  K   @~ K   @$   @  [`L 2*"`L*   ?'`  2` 2 ` `@@  " `@[`L  "`L   0 [ h "`L @  " h㿘 h  @268|confirm? [ynq]269|Press any key to continue: 270|Press any key to continue [: to enter more ex commands]: 161|Press Enter to continue: 275| cont?271|Press any key to continue [q to quit]: 㿘`"! |.` € c c   c@  c c c@@ 0@P㿀#\@ `9` `3` `-N` |) ?@'䀦    "` h   2`  ?& *? `@H&㿐&L  #\@ J` " L L  @ J `2 L  2@ ` `thT >"hT@ڐ  @ + .&  (T!" x!' @ 1!  t x@v  1!$ t t x'(T!$(T1!7! &L `(?& `*` * !X@*:`VJ@ `.J@ * @ L  * .0p`XH@80(|xtph|`XH@0(0 |Äph `P@@0 @|@  Ř <  xp\`XH8(writeanywrapscanwrapmarginwraplenwindownamewindowwarnw9600w300w1200verbosettywerasetimeouttildeoptersetermtagstaglengthtabstopsourceanyslowopensidescrollshowmodeshowmatchshiftwidthshellmetashellsecuresectionssearchincrscrollrulerreportremapredrawrecdirreadonlypromptprintpathparagraphsoptimizeopenoctalnumbernoprintmsgcatmodelinemesgmatchtimemagiclocklistlisplinesleftrightkeytimeignorecaseiclowerhardtabsflashfilecextendedexrcerrorbellsescapetimeedcompatibledirectorycommentcolumnsceditcdpathbeautifybackupautowriteautoprintautoindentaltwerase   !$x%p+h)`/X1P3H9@68705(= <A;>>HMHJKLwswmwlwiwawttytypettytstotltagswsmdsmslowshsectscrroreparaoptnumodelinesliichtexedebdircobfawapaicdpath=%sCDPATH:directory=%sTMPDIR/tmpescapetime=1keytime=6matchtime=7msgcat=%s/usr/share/vi/catalog/report=5paragraphs=IPLPPPQPP LIpplpipbppath=%srecdir=%s/var/tmp/vi.recoversections=NHSHH HUnhshshell=%sSHELL/bin/shshellmeta=~{[*?$`'"\shiftwidth=8sidescroll=16tabstop=8tags=%sscroll=%ldwindow=%lu031|Unable to set default %s optionhР?'''' >  @  e#`.#   @  Z""`."   @v N"!``.!` 2  @j  2B"#X$#`$.#X@h# $#$@@4' @ $" # $@M#0 $#8$@x@'@~ $ #@ #@ ?/'@'@i $ #P #P7?@'@V $ #` #`'?@ސ'@C $ͮ $p〒$@+@̐'@1 $ # # /?@'@ $ -#  #????@'@ $ %$ȖВ$@@'@ $ &$ؖ$@ݐ@~'@ %m *     ? ?'7@g'@̔ %V 1 %@ ( % 0$@@M'@ %< 3 8   8  ? ?'/@6'@ %% 4 P  P ?/'@!'@ % 5 `  ` ?7'@ '@q % 8 p  p7?@'@^ % ;#В$@F@'@L ""֮ = "  * @*`8 ?2 '̀ ̐ '%$@"@Ð'@( "  /h`€̀ 2 ̀"X$  " " " "  *` * 8?'%$@@'@ " H 8 8`_  !     O  "" 0G   @  @ >  " @? * * `8@ @x ,  "@?*`  * 8`    "  * * `8@ @T + @!  ` @?" 8@* @@@'@} 2 @`@?*   " 8- %Y  all032|Usage: %s291|set: the %s option may not be turned off313|set: the %s option may never be turned on034|set: [no]%s option doesn't take a value035|set: %s option isn't a boolean036|set: %s option: %s037|set: %s option: %s: value overflow038|set: %s option: %s is an illegal number314|set: the %s option may never be set to 0039|set: %s option isn't a boolean㿀  `  '@ƙbЀ 2 $   L ' = ?2  =`ؖÒ   L ꀢ =`'-@`@( "L n L o  '@ "@kR `8% :`,*  `2 ` 2  @ `?2    "  0-   '耋   ''H` 2  ,*  a "   *` * 8`   *  a "    *` * 8` 2     @    @ܘ     2²   2  @&7 2  ( 2  2    @   @  ' x` c\ @ `_@v `N"䀤` ` ` ' ' @6    ` `thT >"hT@䀢 뀦   ` `thT >"hT@+ J A ? "> ͐Ȑ' Y耢    ` `thT >"hT@䀢    ` `thT >"hT@  @   (X  ,*  a    *` * 8 @À   @ʖ 2     2  2 @%# 2  ( 2  2   (@  ` 2 "   s- 2. ,*  a "  *`  * 8`   *  a "    * * `8@@G "F   @J 29     2. ~ 2& @$ 2  h 2  2  @ " @ `2` @|㿘.`*  !`  @ * *   8@ @i       2&`` "&`@&`&` 2 &@@ "&@@r&@&@ 305|No %s edit option specified㿘.`*  !`    * * `8@ J 2 2  " 8.` +@  %ld%*s  5" 8 8@0 ?  8  ? @'8 'l8  8 %`: `, ``"0`  ,* *  a   @  * * `8@@ *  a "   *` * < ܐl* אg* *  a   @  * * `8@@ *  a "    *` * < *  a "   *` * <`3*  /*  a "    * * `8@*  a "    * * `<@@ǐ }*  !`v* @* @ ! ,!@` `.?S ! " @@ *` * 8` "A@? !p+!`  @ * * `8@@  @͒ @n' ! "@@*`  * 8`   *  a "    * * `8@@I?l/`" `* " l'l 8`=@ @D@& 2`   @,l" 8/+-$ `'Ф , @*`@=@@l +&ߠl @+" 8,``*`@@l@ l+l@,`+%s%sno%s=%ld%s="%s"㿘" 8&@`: `+ `"A+`0q+` *  a,#x   *` * 8` $ ,  `$#,#@ 0M+` *  a,@ #   * * `8@   j03 *  a,@#  *`  * 8` $  ` *  a "    * * `8@$#А7set %s set no%s set %s=%-3ld set 㿘" 8` 8 2 8 %`):  `>,` ,*  a "@ @  *` * 8`- - -a-a@7` ,*  a- !@  * * `8@@   @` *  a "@ @ *`  * 8` `  -a@-  \2`` \?`&``@ \@* &@@6`?`&``@ @* &@@#`L@ Ӏ ` =?`&``@ =@* &@@ *  a "5   * * `8-@  \2`` \?`&``@ \@* &@@`?`&``@ @* &@@Ԓ`L@ Ӏ ` ?`&`@* &@ @` @ 햔    2  㿀$.`#' %@8  1" *  87'"8.#' N@&  0(' @8  JL & 4@" 2 `  " JL & 033|set: no %s option: 'set all' gives all option values㿘. t 㿘@@㿘@@㿘`@ #" 8`  a  ,@2l @ 2h  @  `*`` * 8` 2 @      F " `* * `8@      ( @ "`*` * <`2 @ " @ " `* * `<@ m  졔  `  M`㿘" 8   !  ,@2F @ 2B @ "*`  * 8`  @  @ "  * * `8@@  @ " *` * <`2 @ " @ "  * * `<@@ `  M`㿘  B    040|Screen columns too small, less than %d041|Screen columns too large, greater than %d㿘/`    / ! 042|Screen lines too small, less than %d043|Screen lines too large, greater than %d㿘 !0   0H !ڰ 0   `?$`  & $X * * `8@ $X $`   *@ *` <  $\  *@ *` 8  HS (P  H   a H  [ B $`2 ` & $X * * `8@ $X $`   *@ *` < @ $\@  *@ *` 8 ? ( ? H  !? H   044|The lisp option is not implemented㿘0@  㿘u 048|The paragraph option must be in two character groups㿘@ ͐ 0 H  㿘+$ $$ $($"$ 㿘$@  @L $*@&$$ @@A $ *@&$ 䠐   049|The section option must be in two character groups㿘@ z 1 ʒ  㿘      㿐 (`€   $@8 㿐 (`€   ;P.@  㿐 (`€  "@@   *` ( 8: 0    *` (8?" " 053|The default buffer is empty054|Buffer %s is empty㿈`H ! `2A1+  #\ `  H*@  ` !@`` `  `@`` 2@`21`# *` * !X7 b  '`6 2X  2``   \ '`& \ '' 9 ` $B? `' '   \ '`& \ @'   ' 쀢 2     "(T!   ' @ 耢 U  x    t@  x "߰ $ t t x'(T!$(T쀢 @ @ O@@'@ D 쀢 `?"  ` '` @  P  ' `@@ $ ~  X y  `& X t& `` $'쀦    "(T t@2`(T >'(T` x@(  t t@ / x "h ' t t x'(T! '(T @ 耢 `@`@ Ӑ`@ ̐` ߭$ 2,  X " `& X & `   \ '`& \Ғ    \ & \     ` `t@hT >"hT@%s055|Files with newlines in the name are unrecoverable%s/vi.XXXXXX056|Modifications not recoverable if the session fails8 *y T3" " "" * * `8@@4 " "`3@" 3F 233? +3@9#N` N 3($@.@!?3@@c &`L  @38  `X  @.`X057|Copying file for recovery...058|Preservation failed: %s059|Modifications not recoverable if the session fails㿐  X @, XB  P `0, X @m 14 +4 4(h `  € 4 L 0 hh  4 hh   L@9! X `@, XP砒  060|File backup failed: %s061|Copying file for recovery...㻘 "| X @ v ` €  4 X ,XL跒 c `` X ,X`P@`K  *k 2D " " "" * * `8@3($@J@8!?'4 (haؐ L@  @  @ " @@  hh  ` ` >  2 062|Information on user id %u not found%s/recover.XXXXXX063|Unable to lock recovery file%s%s %s%s %s %s %s%s %s%s %s X-vi-recover-file: X-vi-recover-path: Reply-To: rootFrom: root (Nvi recovery program)To: Subject: Nvi saved the file Precedence: bulk%s%.24s%s%s%s%s%s%s%s%s%s%s%s%s%s%s On , the user was editing a file named on the machine , when it was saved for recovery. You can recover most, if not all, of the changes to this file using the -r option to : -r 064|Recovery file buffer overrun065|Recovery fileX @P@I   5\   *g 2 " " "" * * `8@? 5($@C@1!ؒ   Հ  5@)  2 @h%T %P   L  / @; `!?"@a#@!@N5 #d55?`##`#h#\@55 a#l#p#x555#th`@6@kn5@@55555apᨘ!Кb#`#p#x#\#h#l#t#d5b0#|#5b8##555#0Xa`@ 5@婒 A , <@@ & <N 2& <8N .&@ 25٢ ?@@ @Ӑ 5hl    ?%T @ .recdir: %srecover.r+066|%s: malformed recovery file%.24s: %s vi: no files to recover. 8 *H ""  " "" * * `8@@   66@1"   6` x 96765535/6d-6"@D  ]@cऒ WT  M   @^0I$@ !@#  @ؒ $@} `@   @Œ 2* 0,@! $"@➐  " 2T@ 0 T@k @ѐ@,-@@  `6@,!#@ %s/%s067|%s: malformed recovery file068|No files named %s, readable by you, to recover069|There are older versions of this file for you to recover070|There are other files for you to recover('H *t ""  " "" * * `8@@c H3ƒ ?  ' ''6bА@u  7!$@6 @   t       ''@u0$@ #5`@A  7@ $@ٔ 5`@-   7@ 2 ,7 -!0N,@! $"@Ẓ   '" @ 0;@ 6@ `'*@  㵔 @  ` 㪔 @@@'@@@s Q @  7ؒ ̰ 01 `7y  7Pp Hؖ  @א@Ր@   "`P"`TH!2 `X  @*`X?c @ ? ? @˔ @?@ 43  3o  㿘@?@  "  ;   @w 0 㿘@?.@& 2`?3@ ?@S@ ߐ?/usr/sbin/sendmail071|not sending email: %s%s -t < %s 9 p@೒ 9 0 9@ʒ(@㿘& @լ$ 2& ⶔ    ` $ $ $ $ ,&  x$ |`$ xa$ ` "d@ B$ d "`$` $$, ``@ `$ `@% +$ ``Ā`$ `@  $ ``܀`$ `@ $ ``䀢$ *@ $  _  耢 2` W 0`$ `$ @D1 d$ @$$  @  &@ 㿘 ? & m ""$ ` "` "  @"@$ @(&$@  2 $@2 x $ "  x@n  @h $ x " _- x " @\ "$@V$@" @.  ؀ "$@I$ @" @!  " @< 耢 @6-@2``"`0!"```  "`    `" "` 2`"` "` 㿈 L Ғ 2s   ` `!@ h ` K2N   'N2 ' 2$@ K @D`@ Ě `  #\  2  \2 @J` 2 @` @*`J@ 퀦2` 2'"  Ě `  `2 `2 #\e 2 `@2&  㿀\ | 2ڰ  B @ S 2ʰ @`20/ `  ' ;  $ " $$ *` * 8`  @  `  d  t @  d @   $ `p@Ӓ l`$ " $$ *` * 8`   `Y@ U`;  "7  ? ?    @  "  ` d@0` @ & &@   ?&     (T`    ` (T`{``@ x\   "``@`('䀢 #@ $ " $$ *` * 8` @0  瀧 '`  d  ɸ @M  d`@@ ``4` ʐ@ ƀ $ " $$ *` * 8`   @  䀢 䀢 2   @  '  ܀ ܘ ?    ?   @  b +   X쀢T䀧`/-@ *  ?쀒   @| )  e d@I   쀢 `B ?  쀢䀌 &܀@   ?&&  ?'>` (T`  ٖ  +  (T`& @p 072|File empty; nothing to search073|Reached end-of-file without finding the pattern074|No previous search pattern075|Pattern not found076|Reached top-of-file without finding the pattern077|Search wrapped㿘`!=!.` €==8= p= ==ޫ 0@B(8HXh078|Searching...㿘 =ha㿈`#\\d @Ț 2 ``  @    "$ @$ |$  @T (  _ ` "8 $ @ $  "&$ @ $  "`$ $  @Д $  b @  @@$b  0 $ $ , $ 2 !D`$ !D"` "aD !D $  $"`"$  J@  @ 2H  * @*  㿐#\ @&  @㿘`"  "` "@ @;@9   @3@1 㿘\ 2$  C!D*@ 2< $ 28  @n  @85`*' 2# $ 2  @ 4 `& 8  " `2&@0  $@    `2&@ 㿘!D " @  " @  "@`"  "` "@@!D 2  㿘 !D  @2 $ 2}  -> @` *` *  !X@Vɐ? `@岒 %@$ !>#0$   @` *` *  !X@*? ` ,8 (@} %@ !>#0$  @` *` *  !X@m? `8f2}%s㿘 !D2 $ ?ax@m`G  |     'S ` `? 'R Y 2`` ?`&``@ @* &@@s`?`&``@ @* &@@su2 ` ?`&``@ @* &@@sa "H` `C  |   'S ` `? 'R  2`` ?`&``@ @* &@@s.`?`&``@ @* &@@s2 ` ?`&`@* &@ @s 2@ " `   ?"` 㿘"*! @@C  ۰  &@&& 㿈&Θ쀢 쀠'`?   "  '' J ? ' 'J   B&㿘@1< / 2 㿘@  Z @H. 㿘! @$"&"``"  ?  㿘! @S$"&"  "   #@  @   %lu㿀`0" @` @ * $$ @  8  #\  &$ ` H*@  `  !@` `  `@` ` 2@`2. * * !X@   < ` ` '@ `    ̧ 2&    ̞ 2  2 ``0(`@Ȑ@؟ 8  ̄   㿘 !.` !`A"*` €@- @̒@e@ @?@0@Th|㿘 !.` !`A#h,` €@ @:@@ @z@ "!(<㿘@ "`@ ?`, &`@ @2 `<&`H&`D  "a 㿈`0 ` *!  "a`42쀢 쀢 /6  ( @`8`0@h'` @ 'J @  `," `&`@`@" `<`4 `8@ `<`@&`D&`H 㿘@ 2  `@ `< &`H&`D&`@  "a㿈`0 ` *!  "a`4И쀢 쀢  9  @L0  `8?`0 '` ?@ 'J?@  " `<?`,&`D&`H &`@@ `8?&`8 178|No previous F, f, T or t search㿘BK 179|%s not found㿘 `B #* *  !X@q. vT@"% $ol $$$$m $$Pq$@$(n( $#H##KD ##lD##`##hlDH#X#(lD##l8D""`""*@ ""mx ""p"h"Hil"@"(p"")!!!!'D!!x*@@ !p!X)!P!0fHD !  *,   3t   xgD h PS<D@" H 0& ( P\C( \D@"D@"lDHxHD 8l8DHql@"O@ xX-H8(D (T, (, qP@"pX P8= (ߠD D pP tF 8jEHjE?, ' xhkDEX8k E0v@"@d ^H 'DpF `H0 (F 8 ׈D xD `8 (}D@ zD@ MlD L D@`P@B"XH>` 8 ߼D BX %0 $D x`F H KD ? lDl8DfHD pPP H8v`@" @ _4 a G x`|F Hl פD ,  P@(ZD@"NDD VD@" xh ~ reverse case[count]~ } move forward paragraph[count]} | move to column[count]| { move back paragraph[count]{ z reposition the screen[line]z[window_size][-|.|+|^|] y copy text to motion into a cut buffer[buffer][count]y[count]motion x delete character[buffer][count]x w move to next word[count]w u undo last changeu t before character in line forward search[count]t character s substitute character[buffer][count]s r replace character[count]r character p insert after cursor from buffer[buffer]p o append after line[count]o n repeat last search m set markm[a-z] l move right by columns[count]l k move up by lines[count]k j move down by lines[count]j i insert before cursor[count]i h move left by columns[count]h f character in line forward search[count]f character e move to end of word[count]e d delete to motion[buffer][count]d[count]motion c change to motion[buffer][count]c[count]motion b move back word[count]b a append after cursor[count]a ` move to mark`[`a-z] _ move to first non-blank_ ^ move to first non-blank^]] move forward section]][[ move back section[[ZZ save file and exitZZ Y copy line[buffer][count]Y X delete character before cursor[buffer][count]X W move to next bigword[count]W U Restore the current lineU T before character in line backward search[count]T character S substitute for the line(s)[buffer][count]S R replace characters[count]R Q switch to ex modeQ P insert before cursor from buffer[buffer]P O insert above line[count]O N reverse last searchn M move to screen middleM L move to screen bottom[count]L J join lines[count]J I insert before first nonblank[count]I H move to count lines from screen top[count]H G move to line[count]G F character in line backward search[count]F character E move to end of bigword[count]E D delete to end-of-line[buffer]D C change to end-of-line[buffer][count]C B move back bigword[count]B A append to the line[count]A @ execute buffer@buffer ? search backward?RE[? offset] > shift lines right to motion[count]>[count]motion < shift lines left to motion[count]<[count]motion ; repeat last F, f, T or t search[count]; : ex command:command [| command] ... 0 move to first character0 / search forward/RE[/ offset] . repeat the last command. - move up by lines (to first non-blank)[count]- , reverse last F, f, T or t search[count], + move down by lines (to first non-blank)[count]+ ) move forward sentence[count]) ( move back sentence[count]( ' move to mark (to first non-blank)'['a-z] & repeat substitution& % move to match% $ move to last column [count]$ # number increment/decrement[count]# +|-|# ! filter through command(s) to motion[count]![count]motion command(s) move right by columns[count]' '^^ switch to previous file^^^] tag push cursor word^] ^\ switch to ex mode^\^[ exit input mode, cancel partial commands^[ ^Z suspend editor^Z^Y page up by lines[count]^Y^W move to next screen^W^V input a literal character^V^U half page up (set count)[count]^U^T tag pop^T^R redraw screen^R^P move up by lines[count]^P^N move down by lines[count]^N^M move down by lines (to first non-blank)[count]^M^L redraw screen^L^J move down by lines[count]^J^H move left by characters[count]^H^G file status^G^F scroll down by screens[count]^F^E scroll down by lines[count]^E^D scroll down by half screens (setting count)[count]^D^C interrupt an operation (e.g. read, write, search)^C^B scroll up by screens[count]^B^A search forward for cursor word[count]^A㿐`0 2 " ` `4`<  N* 2I P  2A `Dɷ` 2 24   &`D+&`H`D     ٖ  &`D`0   >`H @ &`0 &`H`0  > @&`0 `4X#\   Ԓ I @207|The Q command requires the ex terminal interface 㿘 (€  I(\   I L#  c@ P "  3 $ $$0  `4`0(`` `4p#\  | @/<`4`<X#\  j JP @>`4`<X#\  R Jk @suspendX#\    69 JR @180|No previous file to edit Jxћ     2 X#\      @- @X#\   9   !0@@p#\ ;   ՚ @!`0@ `,D X@"@b`4p`< #\   J" $ e  2?  $'4@. ! /  x 8  L &`D P$&`H@;~`4p#\`<    "`$  e     $'@$'`   p0p #\ , #\ G  T @j@㿘`  €@   㿐  K f`!T "!L!L *` * 8`   @ 2i       2_ @:$ `` ?"``* "`@g QQP@=Y < #` ,  & ,| `@တ@r : 2-  x 8    @Ő 2  ` $ &$@=* 2 @ 2    @&㿐 L \  $ L $ P P ` $ P L`0&`D P ~` &`0&`H 㿐   @ 2= @ 4 @Q[  ° 0*  "` " ` "  ` 2( L`L  "`L@&  "$@&$&  307|No ex command to execute㿐 L    L   @)K   Lϡ      $  "$$$ 㿐 ` 2 @  2    `2&  Ò 2 & ` Ŕ`&  㿘 L 잔  "   –     X `*X 3@38303(3 %#0*lo0x%0*lx0X%0*lX%+ld%ldabcdefABCDEF181|Cursor not in a number # +. + -( @( 00(   @Ԓ  4:  L 8#\ @ `      `2w&`P@=ؒ J`0+"`( J  X x2#K@#\ @ `   *L#H@:` EJ `XLc M c I K@ 0``#\ @ ` & *:  8! 9Lc . `#K@ + - @ #\L c   L @ c\   LXd  D!L !  c\03"00  ` *:  8 9' @?Ȑ 8&$ c\ @ ` $c\  ` *:`@#H  $@ $` ` (T!  2' 9  x 2   t, x " $ t t x'(T!$(T @@;- 7x|  t - |  `#" b  |`6   " W | '| @ "|@˯ d$ Y @ + xx8  6 @:"/  'xx@ˌ d`c c@Ր@А"@@ɔ""@"@ 4'D @(` `` `thT >"hT@182|Resulting number too large183|Resulting number too small㿘`  `` N0 @N+ 0' 㿘 @!̢  &`$a,$a !H "!|@[ $aD    !D@[!H!H$aH!| " !@蘿 $a|   !,a!$a!$a 㿘 !0 "!D@Q!D "!|@K!| " @E ! @>@<&  㿘`1""`H`%"#L% " ! #D * * `8@ " "" * * `8@@@*Ɛ㿐`4   2    ?& P   *`" *  `č@x @& `4 & L쀢 쀢 2 ' `"  P @& P `0#\( `#`#d @ 㿘& P`4 P "    *`" *  `:@x @G & `4 & LB쀢 쀢 2'  " `0#\( `#`#d @2 㿘@  㿘@ x@   L `&  2\  2 ''D  & PP ` '*`" *  `ʐ2 L L/ 25  L 쀢 2,  L   2!  L & L 쀢 " L ?`0#\쀊( `#`#d @ x`0`4 >`< &`0 쀢  쀢 ܐ @ & `02`&`8! "!! *` * 8`2`4`4 " `4`4`8 2ܰ `4& L`8 & P  *`" *  ``5`2*`0`4`<@%`0" ``<`4F 2  "`0h#\ `#`#d@4 " ``4`<  Fg 2 `= `8 9`4 5 2~     `8(T! ' 耢 > x  t x "\ $ t t x'(T!$(T@`8H  2G ``4`8 2= `4& L`8'& P`4쀢 쀢 2'* `8 :`0#\( `#`#d @    ` `thT >"hT@͐x@  & `4쀢  쀢 2'!   " H `4 &`<?`0&`@(`<#\ `#`#d@c x@K  & `4H쀢 쀢 , ' " `4`0&`"7  ] )"  < ( &   { [ ޔ } ؔ" )  (" ]  [ "  }  {" >  <`4' 'c 2   `2`    `Tƻ m `4&`< &`@2`<`8 :`<`, " `< @"`<`8&`D&`H`@&`D&`H`, "M  @"H `4`<@`<@`4  'Ѐ 24  Ѐ :`4- `4`<@`4Ȕ    ܐ @' ؐ"  ?J@    ؒ`?'܀ '`0  &`0㿈`, "`4 @"`4`8 "`0`4&`@&`<ꖔ`@ 2 `8`@@8`4`0 &`0`4  ~ 2`4`0( ``, @e "?  ` a h@0``"?@H ?> J  .?"6`,ۨ2٨ (ը !|J` H*:  2J` 2H "?H@2?J  `"@  2?2 `, "&`D @ &`<&`@&`@`4S`8&`D&`H&`<P&`@@7`4@@2!`,Ř쀢 쀢 = :&`8 `8?@ `,`2`,@> ) @ D!`0 > @&`0&`<` `,  &`@ @"`<`4`8`<`@&`D&`H 㿐`, `4 @"`4`8 ?`2`0@e`4  &`4&`0&`8`4 |   2s `0( ``, @i "`8 ?  ` c S@0K`"?@J ?C J  .?";&`Dݢ2ۢ (ע !|J` H*:  2J` 2H "?H@2?J  `"@ 2? @N &`D&`H&`<&`@ 㿘` @M @G`@"! @  2  Đ  !| `@`@ؔ`@Ҕ&!| 㿘`0@@p`0(* (``0" ` `4`D% 2 `D`H&`4&`8 (T`2       (T`  ؠ? 㿘`0@@5`0(* (``0" ` `4`D  2 `D`H&`4&`8 (T`2   ֖    (T`  ؠ?  `πX( 2  3  4  5 6 7 8 9*`(`L`T`\`d`l`t`|`㿘 h€ 186|No characters to replaceh``4 Ѐ 2: Ѐ2 `0Xõ /  ``8`4? &`<&`@@`4 F  $`@2 2 ؐ R 2 ?` +Y"*` € 耢    .!<&!@d $$d @  @2A Πڰ  հ ` ` (T!" x '̐ z̀ Ԁ  to x " $ t t x'(T!$(TԐ@݃Ѐ'!@ "`4!@ 2`8`4&`@Ԑ`&`<`8 2~ `8ԐД"@'Ԁ`(' a "aa`*` * 8`Ѐ Ѐ  JԒ'Ԁ` 'J Ѐ А? 6Ѐ "$&`@ a "aa`*` * 8`2`4&`@ "&`@`4  @ '    ?&`@   ?&`@`4     ?  !<@`4x` `` `thT >"hT@`<`@&`D&`Hb bdbdbLbbbbbbbx㿐`4   !G  `0(`8`@`&`@`8?@2`@`, " @2`@@1 & 􀢀 ?`,`&`@`@"`<`4`8`, "`< @`4&`@`8&`D&`H`<`@&`D&`H 㿐`0("(`<` #`4&`@t`@ 2N `, "` @" ``8`@@8``0 &`0`&`@+ 24 `< &  "( ' 2`,`,@D!@  ?` &`@`@"`<`4`8`<`@&`D&`H 308|Enter to execute a command, :q to exit187|No other screen to switch to㿘$@@Z  @" #  2 # Z H     "$ @ #$㿐`0(` `   2  " @1`4     " &`<@; 㿘`0(`<`? @Av   @' 㿘`< @Ah   @ 㿘`0(`<`? @AT  @  < @" D ,"" H 0 4@@ " 02 4 8:  4D @  8" D" H 8" D" H㿘`0( ``4@ "@ `@&`H&`D&`< @`4 㿘$@"0 @2`4@0w㿘`0(`4`@` 2`,@`4   &`< @"`<`4`8`<`@&`D&`H 㿘`0(`&  `<@;ޖ   `< `@&`D&`H㿘`0(`&  `<@;Ȗ   `< `@&`D&`H㿘`0( ` @   ""$`$` @  $X8*` *  0 $X @~  *` * 8   8$X* * @j  $X@e  ?`<@;w   `< `@&`D&`H㿘`0( ` @   ""$`$` @  $X8*` *  0 $X @-  *` * 8   8$X* * @  $X@  ?`<@;&  `< `@&`D&`H㿘`0`<( `@;   `< `@&`D&`H㿘`0`<( `@:   `< `@&`D&`H㿘@" 㿘@ search+%lu188|Characters after search string, line offset and/or z commandx`0@   @ p` / ?#@ "#8#8 *` * 8`"" ""  @x 2߰  x`8 ـ 2` L&`< P`,  &`@ @T `< `@&`D&`H $ `$!$  !`2 L@$! L  PJv܀ 2 $ ܀ 2&`H`  "l `<d&`<h&`<p&`@`<1 2`,`<\ `   O8 &`H " @  @Ks`[ @L zc\#\ @ `    `2 Ӑ *`:  + ^  ;\   \   25   2, `<\@ 8   2  aȐ!2a`<`@&`D&`H`0 > @&`0   &`H&`D 㿘 ``"     @t 㿘   @j %s%s%s[[:<:]][[:>:]]㿐 !4 `   (T!" x' —  (  t tt x 2$ t1  t x'(T!$(T ]!0]]␔b@. : @@    ` `t@hT >"hT@~189|No previous search pattern㿐`,   @2  !`"!`" #\ `#\`4`<ݼ  `4`<Ϛ " `, ^Ԓ  @j "`< @ @  0`<`@&`D&`H 190|Search wrapped to original position㿈`4`<@`8`@@ ^@ M "`4`0 &`0`4`< 8 `82`4`8`@@( `4&`4`@&`<&`8&`@''`4`8&`D.&`H`< (`@ &?&`<  ˘ 2 쀢  ?`4&`@'쀢  `8쀢@  `0 &`0?&`@ 㿐#L " #D#D * * `8@ " `, "`0 @"`0`8 "`0`4&`@&`<ጔ`@ 2 `8`@@`0 &`0`0( ``4R NJ{ `, "J @ }2 J?2<`{")`,0&` H&`4&`0&`8`< `@&`D&`Hx`8`4 '' 2ư `0( `  j   e 2 ?2[ `4@o`8䀢@k  ``2H ?2E   T 0 O0-?I̒ ݠ?B )?`T#`#*` € ` `" `` 2 ?2   T  C   `4@ `8䀢@ @J ; `,&`< /&`@ @"+`<`8 2!`@ 2`42`@`4  &`<  ܀  ܀  ?&`@`0 &`0?&`@`4`8`<`@&`D&`H dpHPPPHHPx`4 `8 2`4 `8 ''f 2 `0( `  ; 2ذ         {   2 p  ."  ? e !0QP ^ \8 ` )" ]" "" '`   2 `4s 2t `4@9`8@6 \`` " `!''` `   ) ] " ' V 2 |&`<`, ,&`@ @"(`<`8 ! 2`4`4 &`4  k܀  ܀  ?`0&`8 &`0  &`8`< `@&`D&`H㿘`4  㿈 L&`D P@^&`H 2Y  !`$$ L ! $$ $ P  *` * 8`2  $ " $ $ "$$ *` * 8`   #`#d#\  @  $*@$$@h   4 2`D$ @$$`D $ L`H$ P4Pa"a"a"a@"aD"a<"a@D"((aa : a !!  !"!a *a "   (.!"!@"<"@"D 㿘 4 M a& <a& Da & @ 8 < (  hl€  @ (  < *` * ?@"a?$a" " "" *` * 8` 2a @8  2  !a@a a$a 4aȰ 191|Abbreviation exceeded expansion limit: characters discarded 192|Illegal character; quote to enter㾨`xd`x` \'H`$d   @:$ (5$ $$  $  $ @ $ 5 " $ $ 2& " & $ 8`L $ `P$ d@ ' "  $ (' $ $ d@@   d    @@ ߰   $   $ $$ $ $d@d  *   $` $ $ $ $d    *      $ @/$ d@'' d " d|d|`* * `8@" dx`8" " dpdp`* * `8@ T ', 'd2  d@  *@'d d@'  /#/#d@'''4 '('( $`L  @&$`P ` H 0@d( Q 4 "d 2 '!\ `4@'4" ''Ē%!\%!X%!T@&@& ?` j"*` €d $&$d@&z؀ ɰ 0 @4 >d @ ` `!D  + 'd `2e  !% aT aL`* * `8@ `@aL `*` * `8@ J @" @& a a`* * `8@ `a `*` * `8@ J @"  "D$ 8  $@=$ 82 @O4  !'  c d@h'' $`. "!H*   !D!H "j%!D-`!D"* #"" " """d@ -`"!D* @``"  '    $( ? '( '(`?   ' ( $ 7$ ( 2' 0''`c\   `D`2 @  '?`j"D*` €dh@  @-   d@@c  N   $@q o$ 8@T  @  0@, 2Đ0d2 (  d@@h(d "   ` ?$ $   $ 4$ $ 0 @-  d@ (@ 7$ ,4`x  J@ @  ,  $ ,J " , " ,B"@ J " , 29  , 1$ ,J " , " ,)   a  a`*` * 8` `xa `x `xJ J " "  2 0&`|& `x@2`|$`x"$`|& & ( d `*& ` x@u 2` `` `thT >"hT@    @Z    `8& \` X2 `"-'         ى "֐& `\  X@@@ϝ \`X@  @  & \  & `& (X& '  ( 2! 2      Y "& d    'd*    `& &  @,  d @>`  *@ ` '` 'd@$* ($ $ ('d  $@ $ 8#   $  @  $ 8(d@(T  @  0@r, K0;d(  d@@(d  d ` ?$ $ d@@`x@  (d "    @   (" $ d @ Ȓ`x         ر "$   *@  ?$  @+  ذ 0  @d 2   @d 2 d  W`"  <`"" 0F`}d $@ wd''   h "'  @΁  ' '`^d $@ Xd     *? $  $ ("@  $ ($  `Ed $@?@  @ԙ  $ @d a$ 8 `x@(d kΔ$ #   *@  (   @ $ ($   2  `x@d J  $@(d  @ $$  @ (   @ (?`$   $ ( J? "  "    d   ( $ ($ # "  *   @J?  @ 8 (# ( $ ($ #   *@    J? v u    ?c\ ` _2'0 '0 @ c  ( $ ($ # "  *    @ \ ` _0 0C J? ? = @ 8 (9#  2  `x@]d   $@8  d@@  @ $$   (" @$ (#     ?$ * @ 8 #$ #  /#d$"@c  g d@ ' d*' ^, (   ?'i'( d'd @c\  `   c d@2d#\  ` 5_12 2 T   0@9, 0d @"  (  d@@( #\  ` _  d@ޔ `   (?`$ $ (  `'@u '"@'o$ $ d8@ I0 0 "     ' '       K "$ d  'd  *  ` $ $     '  'd@$2 `!`  @)^  h  "!\`!`2 '@c Y '!\ 2dT d@4   @4 @ 2 `!`2# $`L @ $`P@  - #  H@# " d@(Ɛdd*  $d%!Ld@   H"`D H" H@ x tPP,ȝ㿈'``$@ ` 0  ? , *#\ ` ?_? ` ? `2?_"?? ` ? `_  2?"``$2 @@’  D'@'@ 2@ #\  D 4/    2+    ߘ  " `"&` *` `(&`("  ``(   @+@ `( &`( `$@ " &`' 㿘` ` J  2``  @`$@2@  `$@2  @g  ? &㿘&``y`$ u` q@8#&`&`k&` " ## * * `8@` `?`  ` 2 2 @ْ& ?`? L@  @ ꀢ` <  7 @ս&@շ&%$@ "" %@ʑ$@``"@"`&`&` ,@`  ,@` &㿐'P`' A  iP P8 'P `? 'P J@ "P P@2        '  "  @2 @'   @*' 193|Already at the beginning of the insert㿘2 4@26l / ( $  2  *   `$ $   ?&@&`"`@"@, `@'   㿐#Ā " ## * * `8@#| " #t#t * * `8@` @  `J  @͒$ ` * @ *`!]   ``@ @Ա%@@Ԫ$`$ `    (`` `(?`$`&` &`(`J? "` "`` @  `J  @{$ ` * @ *`!]   5``@*`   @\$@ @V$@$`&`  /@S ?  /@G ? 㾨&`  ` `` ` ``` L@  2` ```$  $@ ͔` "$ &`` * @,@#\     C  2 C` ,@ ,@ " 6 2  d@ @ @@[@# R@*  <  @2ΰ  d@Ȱ &@ϒ 2 ? (`-  `* ?@ @ 2 : @@@  " ݠ`@   ` ?,@`` ``("@&`&`( `(  ?,@`(` `&`&`(`2 + ```  $@ ` "W &````@` &`&` @@??  ?,@?` 29 @ 21 <  2* `( ?` ``  $@ ”` 2&` `` `@ג` &`&`(` / &`,@  %s %s%*s 㿐'L @'H@4 / L@H$L` `$H`*  L@@  H `%L @ @  * @ *`!]   ]  2 8`ߤ@҄ $ "@ *&$ '' 8,%nf@H` `hT`"    ` `thT >"hT@PTf @Q?H@  @JH@< 2    Jn :;n9n7nL,`@bhhB    ` `thT >"hT@ T (H@@ "p&h!xT` Lnh9T`* nbh.T`2ThMT ?%T $ &$ 㿐` 'L!]J@ ؀  @`L@! * *   '(Q```   `p` 2&`K `  "`L@ @@Ɓ``&``(L@`&`(J`  $'L , ` * *  !X@CL 'L @,` ` $L+ `@#i 㿘@  `2`& L & L$& P @&$㿘` ` *``J   @"``$@J  2` ! $" @OՔ " 2`(`` `"* `* ``"`" &`&`*`("` `` @` "  ```(  @ޒ 㿈@`( Ȑ?&`(` `*@ &` "`` '` @ *@ `@!``*@*  * a] @ '~ &`(`J`   `@  *  * a] @j'"c'" 'V``   `R` " &`"` @ `(@` `@c ``(@`&`&`(J `   ??(  *@??`*'  * *  !X@@ $ ?`?    ?*@?` ' `( `"  &```( `  @ "'```    `` 2&` ``  &`2``` @  * ``(  @ ` `* `&`㿈 4 2M 8`4 `8&`D&`HJ?`\2 #p" J? \2 #p " #h#h * * `8@ @qQJ "`" `4@J?`\"`4`8&`D&`HJK? 2 "`4K? \"  `4 `8&`D&`H o.!Ȑ`3!$* &$ 2b   @`4`8`D H`H''J / #\?`D  #\?`Dۚ 2`D& L`H& P . a  @ )  .` 2"  ?Ȑ# @2$  &$@& a@  @Ζ 2  h€  㿐@#`'``` 29  `@!%  2/ ` x@@$`'``  2   `@!  "@  @@ $*@&$ Unmatched %sx`& L`& P@k  2{ ؔ @)  2s ``?' 'ܐ 2g `) { ( %rk N   `` H*` *  !X@q. > ڠ ِ?؀  ܀@*'  & P& L@ 2 "P ""H"H * @*`8 * *    *` *  *   @ ` `H @"J"`$@?D"I  2` "`"`$` 3  "` `( "`(`  #``( ` ` #` #` `(` ` #`#` #`(I   ```#`@#``$@2? " 㿐( / @ x@2``, @@ &(8  Ә @c@("@ " & &&(194|No more characters to erase㿘sV 㿐`0 `4(#`8!``&`H *&`H#@$@&`H? @O ` 2  `  ؀ ? @  &`D 㿐`4 f 2!  `4`8`0  `<"`@@ "`< `< ܐ 㿐     (T!" x'    t x 2$ tF  t x'(T!$(T@@`@  \@   b H*`@ ` / * o 2    ` `t@hT >"hT@㿘&`H   X`*X L"4㿘 , "a  X 2`0   *X@4   "44   `D В`D@195|Movement past the end-of-file㿐`  @@ t @̔ 0' 196|Movement past the end-of-line㿐`@  m `?@t @ 0 197|No cursor movement made㿘u0 198|Already at the beginning of the file199|Movement past the beginning of the file㿘`u@ uupʒ 0Œ 200|Already in the first column㿘u  " J     201|Buffers should be specified before the command209|The file is empty202|Already at end-of-file203|Already at end-of-line204|%s isn't a vi commandWindow resize interrupted text input mode205|Usage: %s㿘.u#h. €uu uu G 0  u>@0 u`8 0u2 L4㿘@  㿘@ 㿀`0( ``4`8 '' 2   '  !`,@ D! `a` 2װ ? ?D#%5D|     2 `,` `@Y@0U  l נ?h`,   #\ ` 5_ 5 \ `_ 0  `_ + S :   ހ `,@D!!P2 `,J "`,O    O   ?`, " @`4  `8@`4" `,&`<  &`@ @ 2`,&`@`, " `< @"`<`4`8`@&`D&`H 㿘@  㿘@ 㿀`0( ``4`8 ''p 2ǰ     2      ђ 2 w w?l  n  2 E t "\`,?   #\ ` 5_ 5 \ `_ 0  `_ * E ,   ހ   "`,A    \   ?`, " @`4  `8@`4 `,&`<` &`@`@"`<`4`8`<`@&`D&`H 㿘@  㿘@ 㿀`0( ``4`8 '' 2     2      O 2 w w? ~ n  2 E0 k \?   #\ ` 5_ 5 \ `_ 0  `_  < ,   ހ  - 6    ڒ   ?`4@  `8@`4 `,&`D&`H&`<` &`@`@ `8?&`8 206|No characters to delete㿐`4 l   x7  2 `0x' , (`@`? &`@`@?@*`8`8&`@` &`H`0" ``<`4 2  c 㿘`8`2`0:' ( ` "@ &`8&`8`@ `8?`0&`@b&`H``<`4 R 2  3 㿐`0" `3  `4:`< 2# `4 t `<`" @ & t`D   `0   >`H @ &`0 &`H 㿐`0(` '  Ғ  `4'`8&`D`0 *&`H` "'`$` $X * * `8@  ``$X `"  * * `8@&``@~ 2y ` -" . + `K ^% `E@T = @N 7 `0(@E  2Q `D @"J &  <`D `0(@/ 2; `D @"4  23 `D@    <`D @< # 0" 'S 'R  А   `(  0 @    4"<@"D"D"<< (a("a@"㿘  X`            $ "$$110|Vi command failed: mapped keys discarded231|Interrupted: mapped keys discarded236|Interrupted0`  L@ې0` @h$0  ``  h  ```  h`Ȓ`40@ 20` L@D `Ȑ "0d``Ȑ("```Ȑ >"`0 ! "*D % "0 " @"$H0!" D0D@ @$H @ 4DzH )D@D$`LH$`P0@@@  @ 'H  " `  z `(T`2`    2d`(T`"d`T  "T zȒ dz d@*@ $d` `` h`Ȑ`4@  2+ d( 7`$d` h  (T 2&d "`&@ `  *`" *  `2 Ȑ @  2 Ȁa?" @ 4Ȑ $`@j 2 0!` ?Ȑ# @4Ȑ@`T` *`" *  ` '` X' | `C#$(  L@™`` @` |"8*` €=~ ( @ "'0 cX "cPcP`*` * 8`2 0 "0 `*` * `!X@<ܔ  @  `"`(p`0 $0`L'`P'`L$4$D$<`P0$8 $H$@``@֔ "0`(T`2`    Ґ`(T`2`ː0 ((2`,<? $<`, $`,(@€ dF ̒ @"   @#G  W&   `(, ` ~ change case to motion[count]~[count]motion234|Only one buffer may be specified208|No command to repeat210|%s may not be used as a motion command211|Already in command modexب@ `? @   2& &&&&& $&$耢  쀊  '@ "0      @  耢 쀊 2'@0b.&0 @  耢 쀊 2'@#\  `  0 @Z װ 0 (&0' @  耢 쀊 2'@'"4 0"  |   @d  耢 쀊 2'@0b.&0 @P  耢 }쀊 2'@  ~  , * `!X@ u B, #x@ D .0("'0& 7&0  ~@ X ~2&( d "cc`*` * 8`|&( |"P&( 2F0 . , * `!X@k耢   Ő& `t``,! 2 `00D &0&( @20|X(h&`0&`0".`@ L hD2" @b:@ @  耢 쀊  '@0".&0 `[`]`Z>z @{  耢 쀊  '@䀢(2 ~ d "cc`*` * 8`|x |"Xx*  +  z8 @=  耢 j쀊  '@.\ `  @ j 0 &0 @  ]耢 G쀊  '@.  |` "*` * `!X@x5 6  @  *耢 쀊  '@.@ @      " `0 |  d@ @0#  ?????????'  @ϔ Lئ@ '؀( 0( '@0'ؒ w(d'&0@(|0` &0 L &4&8  L@  &< < I c !Cs&@  ?m&@("P@'D#&(  0  !А >&0`ؒ ~ L  P'''''''@€ 2O < `<  c !  : &@`P&(0 !@!&0&0&,䀢   耢@( &4&8&< &@&4&8&<&@&D&H( @ @ L&` 214|Windows option value is too large, max is %u㿘  (€  2r (\  $ " `  $$"  * * `8@" $a !`  $ 4!X * * `8@!X $`  $ 8$X * * `8@$X 4$ D$ <@ $ <$ Dƒ  4?$ @$ @ $ Ha @  "a <  *` ጑* ?@"   L" a"  a"$ $$aȒ`4aȐ   %d screens backgrounded; use :display to list them㿘 ``, ` ! "@ "!@` $`  "` @ $`"@$`$ `@2`$`"$``ڨ `@ $` "` @ $`"@`&` & `2` $`" $` ؖ?1 212|Cursor not in a word㿐 L { 2j   P#\ @ `         `2  p C & P@   @ \ ` _  #\  :"  ` _   ""'a4 a0a4   $a0 a0@@a0*@㿐@ D S C $0 Y  _0  c $ d _ c y/.@     @B*`#x@235|Number larger than %lux/ %, *  ?Ѐ! @( 2# #\  ^?  @  c\ `Ց, &  㿘  2* ?` ! #*` € 2   hd€ 0@  ޖ  ` Ē d|%7lu $@'L'P !\`8J $ "` !&@ *` *  *  *   @  4 :  2/ `L@ `'T " #  tpp a &@ *@ *`@ *`@ *`@ 萟:`@ lh"  8" *` * 8`2 ` `" "`` ?@", " "$"$ * * `8@'`'`$@.'\"`  '\" *` * 8`0" @ `x@@d 8 XLh _L T@ L@T !&@ *` *  *  *  L : "@ 8P"@"T`~`&`&` .`/.`" \@  ~\ `" $  , *  !X@N ,  * a] @:Xl@萰 tp0E`T &`  l` "``3'l" *` * 8,` !@ . "+"@@2&"    l&` .`"` 'l" *` * 8`" 2 8@L 8"    " *` * 8` 0K" H >l   !'l`` #Ā  # * `8* @ # *`  * 8@ܐ$ *  * a] @h  lS 8l$?'lJ$@ Cl   !'l`  #Ā  # * `8* @ # *`  * 8@$ *  * a] @Q h$ 8h  ll$@?'l&` .` &` .`L`T@ L@ T P@  "@T 8 h hx `? 'P'X'dަ l   $'l` ! #Ā  # * `8* @ #*`   8* @'$"   * @ *`!] "ޒ"   2.`$$@.`.` $$@.` 'd&`h HT?F`$ 2 d =` !&@ *` *  *  *  L : "@$@ P$"@" """ *` * 8`2$T T$@ T` P@ "@T T`@  X9x X $,X,(h x,$Xxx ` *` *  !X@@P   @,`h & BP` .`&`&` .` * @ *`!] .` .`h`?&`.`\   b5X ,x$Xxx  "0 @,`xl@x $ ,X萰 tp㿀$  d  a`p aa@M)" """ *` * 8`2`` "`` 2- @` 2  ( a $@ + @ *`@ *`@ *`@ :`@ @\  8 X `a@(" 㿈$  F " !`h"\!\h!\ `$!` 2h $!d@ߐ!thp!l!p7 4 @? h hXhp!hhl@ 4 @? !hhch!``^!\ $!``2!p 4 @? h hl@!ph!lDh 2Ah!` < @z!t G#@ *"@ *`" *  !x* "@  +$!t!d`$!x$!d 4 @? !hh!d\c $!dhX  4 @? !hhh€ 㿘 4 @?  萔  h€ %s 㿐$  "8`"@"@PQ=hp 4 @? h hl@` @ 8 8 hX@ 8 @ "hXhh€ %.*s. ; 㿈$ @ hT ` hT hd€$hT$hT $hT$@`5``` h€  v ߀`h\  #@\`2h\  @g!`$*@`&$ h€ 0`2hp@g0` @ J?` " 4 2'  'X 8`?   P@ P@  @y $P'iJ J " "[X($  J  J  2  $ N " & J " "& & 2 " "  J?`."" @' @   (T`     (T`hh€   'H @ '!X 8  "@ 2[ 4 4.!\ 2!\ @ ? l@@k!!\`!T 5!%!\%!T!\ @@2!\!Ȁ ?!T? %!\%!T5!!\  @  4 @?  !\!T`%!\%!T (T`  f  H (T`v  H @? H ?\  ?x&=N "   ,* a] @@ $@,@X,*  !X@??  @?,@`?` 2Nx@  ,@X$@ H 2l\  l@%!X `4' p!Xt.x  &@!!X ` 4!!P  $!P$!X$`  h€  "$s @2 $!\ *@g&$$* @ '&$ (T`2#$    2$ (T`2$$" @`?`@@@@ 2< $ " !Ȑ 4!  @"!$ @&$!Ȁ "h\$ &$h\  $?# @&$!\  '!\ 4@ " ''$!T$!\$!X@p $!T$!\$!X p ` hpԟhT  ?$hThd@$@*@&$ L  `l "(\$ 2`l@_  "`lJ    `"  "` "@@ @`l 2hȐ 4\  2 @'  Ȑ 4  @  4 '\  "@'' $T $\$X@h԰ Ё㿘 4 & a\   @@ "@ "( (t€ `  4 @? ( (@aT @@ @p 4 @?   h  4`       @OhX!\$!T`$!\hl€h `2&@؟@ ]   2hd q/hT $hT   q hT $hT :`2&@+=+=+=+=+=+=+=+㿘 8`8   (\ (XbH(\  %.*s 㿘 @E  )@ $ @ $ $  l`2@$ l& l$ @ 2@@ $@" "@$  @!b@~㿘` `8  *@ !*`  *  "`   `  &`  㿘$ @  @"$ &$  "  " *` * 8`2  1" " 1"$&2 ` aȀ" aȐ `@9` aȐ 2a耦`  $  !`  @"   '$  2$`€ $  $$h$    $$!  L L   @ 24 $ @&$ D @ "  ! L@:*!@a @`2` V 4 R   < @@`@T" 蠄? < v& < @@ r@(m @5 @`2` * 4 & \  < @@W@`  a "a  ! ? < ?& < @@ ; 4 @? ( (l@ < D($ L  aa" *@ *`@ *`@ *`@ (:`(l€ < & <?" < D@8  L   L@ 0@("$!2 2 L <  2  @ <`2` 0E C??""@  @??"$!x 2r L <  2   @ <`2`* > 2;  a ??"_"@z ??U"܀ 2"    L'!`' <@S' <`2` * L 2' Lܐ(  '!`  <' L`'2` @1 <`2`   L 2 L   @- 2ٰ $ @&$" " "" *` * 8` 2t$  L   2h$  P@R a L@2* `@:&  <`"2`8  (  a" @ $`@ &$@ ڐ 2  !`@  ! L@2-$@()$ <`$@2`8᐀( ᐐ"` @ $`@&$ @ ($@  2[  !`@ $ @`" """ *` * 8` !  !""Ȁ 2  L2  P@ ؖЀ Ѐ 2   P Vؐ 'Ԕ"@ @     ? 'ؔ  * @ *`!]  dؐ   ? ,`@*`!]  `L ` ,` * ]  "@ < "@ \"S$` '" 2   K'ؔ  * @ *`!]  " """ *` * 8` 8  8?:$$" """ *` * 8` 8  8?:  (p̟ ! L " "  2  * @ *` 8  ?   P@" "`" * * `8@2  "   )$# "## * * `8@ M   * @ *` 8 # # < `8 "  * @ *` 8  8   8?   ".$ 8 :)$# #* $ `* `"   8   `" ,$ !! ' $   a($   @2 ?'$ ! 8Z L@T ̀?" H$ !!  ?,   a(, ?'$ !! 8$ ì?" Ā "$  a$ @  D @ " <@ 8( (l@ @`@ (( Ā 2  P$` &$T$ L$" """ *` * 8`2` `Ȁ  ` 23 `2`` 4 `Ȁ  `$@`@<` (̟`@w T (€ `$? >&$ȔJ @ 4Ȱ ????p?`219|Replace218|Insert217|Command216|Change215|Append%lu,%lu x A 4 @?  (   @   "(l  L` 8 L 2 ?29 ` *`* @ *`!]  :`}(#   bq b*  #   ` *`* @ *`!] $ :`|$8  ?`L /  9   bq(Xbl  b(Xb'L `* *  !X@*`:`|ː `8 *` * * a] @:`|(X L  (l@ 8#( #  *` * 8`8## 3@ܐ L @T 2`$@ 2` ' 4 @? (  (Xc ؐ (X؟# # *` * 8`2  #   X`2 L* &تؠ$- 4 @? (#`" ## *` * 8`2 0   X`  bY(XbT(X؟㿘 " " *` * 8`2  " " @` 8@ڐ?"  " *` * 8`2 &@" "&@&@ 㿘  " *` * 8` ) 2 a a   @ 8@8@ݐ@ " "!"a㿐` 'H H` H  2'̰ ", " "$"$ * * `8@" " "" * * `8@"   " *` * 8`2  "  2M??' !`#Ā  # * `8* @ # *`  * 8@b&@*  * a] @{ @ 8  $ @F$@ ??'E` !`#Ā  # * `8* @ #*`  * 8@&@*  * a] @zג @ 8  $ @$@ 2`   "5@ $@'㿐  ~ј    ?0  T @ 㿐 ~` ˰ ", " "$"$ * * `8@" " "" * * `8@ 8@@Q : 8 $ `" #Ā  # * `8* @ #  *`   8* @w$@s$  * @ *`!] @ z-@ 8@* a 2 8  8$@Q ! ` #Ā  # * `8* @ #*`  * 8@'$ *  * a] @y@@* %?80 @ 8@  &@ @$@ 2 ?㿐 ` `      ` @ ( @1"  < " <s @"  L?" L ?& L"  L " L  & L!Ȑ 4!!$! 4! L2$`4!$@2 `2! !\`( !Ȱ  04!Ȑhp􀦠"00@ @ 2 !Ȑ  4!@# "   @ h 㿀  <??!*??$ @ &$ jK`0 <'''䀢  2 @ʔ < 2 @`1 Ȱ '  < `'2`@ < 2 @( 2 <`8/ < !" !" !j" "    a" a"  a"   maximum option value is %d -- %soption requires a numeric argument -- %s㿀b`'  @h 2bX @hؖ 2] `&` 2 N"@㚒@ gN u2 Nb@L "  N <2  b@L  `( 4*@  @ `" @o@ <J`#@e@ 2 `(* N ^N `(`? `-   * `(*  &`  illegal gfmt1 option -- %sillegal gfmt1 option㿘 a0@ aP@ gfmt1:cflag=%x:iflag=%x:lflag=%x:oflag=%x:%s=%x:ispeed=%d:ospeed=%d 㿘 ! @ ` `%   @ @  2 @q@e!@:%lxcflagiflagispeed%ldlflagoflagospeed㿐'H@@G : 'H H+ 'H/-@@9 = 2,@,@`@*N@ c b@K 2N@s&  i2 N@b@Kܐ 2N@f& i2N@b@Kϐ 2 N@b@U& $ l2 N@b@K 2N@H& o2 N@b@K 2N@;&  ob@K  b@֔*& ( `  ' N@J@2  @K 2  ? @  , 2 H H  H@‒′ N@ ittyspeedsizesanerowsrawostopostartospeedoldnlnewlcaseispeedextproceverythingekdeccookedcolumnscolscbreakall㿘@K0@illegal option -- -%soption requires an argument -- %s㿈@L@ -2&` &``]`"4' @g  2 # 2  ` "P@͒@   "  & &`"h@ἒ@  @ 㿘   D@ 㿘  " $@0 " `  & & & & $㿘@  & 6 F $  ߆C w   " * +* -* 0" $"    " * +* -㿘   D@Ö 㿐    ``'@   '``@ & 㿘 @ @[א &  @$**@"" "$@$   """$ "     " "  " 㿘 @ @l & 㿘  @0 @  ?` # & & 㿘@c  & 6 D   $g`  ˒  " " " " $" %d %d 㿘 F"@ D%d 㿘!"@cd @ŐTIOCSETD㿐 `'@ c@^ TIOCSTART㿘@ `n c`@N TIOCSTOP㿘@`o c@> H@80(   #3#3233#@@@@xh`X-mdmbufmdmbuf-crtsctscrtscts-clocalclocal-huphup-hupclhupcl-pass8pass8-oddpoddp-evenpevenp-parityparity-paroddparodd-parenbparenb-creadcread-cstopbcstopbcs8cs7cs6cs5  @@xph`XPH@80(   -imaxbelimaxbel-decctlqdecctlq-ixanyixany-tandemtandem-ixoffixoff-flowflow-ixonixon-iuclciuclc-icrnlicrnl-igncrigncr-inlcrinlcr-istripistrip-inpckinpck-parmrkparmrk-ignparignpar-brkintbrkint-ignbrkignbrkph`XH80( @@@@x h X H @80( @@  C$CC$Cx-xcasexcase-kerninfokerninfo-nokerninfonokerninfo-newcrtnewcrt-crtcrt-pendinpendin-flushoflusho-tostoptostop-noflshnoflsh-icanonicanon-isigisig-prteraseprterase-echoprtechoprt-ctlechoctlecho-echoctlechoctl-echonlechonl-iexteniexten-altwerasealtwerase-crtkillcrtkill-echokeechoke-echokechok-crtbscrtbs-crterasecrterase-echoeechoe-echoecho  @@x-onoeotonoeot-oxtabsoxtabs-tabstabs-onocronocr-onlretonlret-onlcronlcr-olcucolcuc-ocrnlocrnl-litoutlitout-opostopost㿘c c @F 2    ` *@&`   &` U&`  2"L`"L @FՐ 2    `*@&`  &` ;&` 2!`! @F 2    `$*@&`$  &` !&`$ 2!x`!x @F 2    `*@&`  &` &` 2 tablet disc; slip disc; ppp disc; strip disc; #%d disc; ispeed %d baud; ospeed %d baud;speed %d baud; %d rows; %d columns; lflags-icanon-isig-iexten-echo-echoe-echok-echoke-echonl-echoctl-echoprt-altwerase-noflsh-tostop-flusho-pendin-nokerninfo-extproc-xcaseiflags-istrip-icrnl-inlcr-igncr-iuclc-ixon-ixoff-ixany-imaxbel-ignbrk-brkint-inpck-ignpar-parmrkoflags-opost-onlcr-ocrnl-onocr-onlret-olcuc-oxtabs-onoeotcflags-creadcs5cs6cs7cs8-parenb-parodd-hupcl-clocal-cstopb-crtscts-mdmbufcchars%s = %s;%-8s%s Ȓ& ```" `"@ @ @  @!@~!@k@_ ! @q!@@k`@@c!P" @\!h @!p! 4 !x `@@  4 ! `@@$ 4 ! `@@  4 ! `@@  4 ! `@@  4 ! `@}@ ! @s@  4 ! `@h@ @ 4 ! `@]@  4 !Ȓ `@R@" 4 !ؒ `@G@ !4 @=@4 ! `@1@4  ! `@%@4 " `@@4 " `@ @( 4 " `@@4 @""( `@@@ސ"0  4 "8 `@@! 4 "@ `@ܐ@ @ 4 "H `@ѐ@  4 "P `@Ɛ@4 "X `@@" 4 "` `@@$ 4 "h `@@( 4 "p `@@4  4 "x `@@ " @@  4 " `@w@  4 " `@l@  4 " `@a@ "  4 " `@V@ @>" " @H@  4 " `@=@  4 "Ȓ `@2@ @ 4 "В `@'@  4 "ؒ `@@  4 " `@@  4 " `@@ "  4 " `@@ @"(2 #4 # `@@ #!""  4 #4 @ؐ#4 @Ԑ# 4 @ϐ#4 @ʐ# 4 #( `@Đ@4 #0 `@@4  4 #8 `@@4  #@ `@@$ 4 #H `@@4 @#P `@@4 #` `@|@! @b#h ` %` @@ dp@n@b` @ 2`@G 0C@D   `2 #c d,`` " ` @%@n\`( @c@nQ 2 ` @Đ @` @ ؀ !#@@(㿘! ! @!h$! "!%s: %s %s %s㿘! !   !@#$!@!@`H @##@ $!@z#!@$!%d㿘 ?  1 !P@m 0% 1  X !ؐ M.!ؔ -*  ^* ? *4* ^*@**!؁-aefgaef:g%snot a terminalTIOCGETDTIOCGWINSZgfmt1illegal option -- %stcsetattrTIOCSWINSZH@Oz'H"# '#'H8@[?2 e"  f a c+ gc% ! "@m9  '"a@@ؗ  c@H*` @wa0cH*`@ cH* @,'H aH@ `@) aX@j `h@ `@؎!h` `H H` HHH''@ GH -+ 4Hђ .H (Hc\  `  @  @̐@R'x@D!  H`'a@d@1H 'H Ő  @^Ē a@    `g@ @! usage: %s [-a|-e|-g] [-f file] [operands] 㿘P <aP@\y!@n 㿘@ Ffhns.%s8@Np+) ' % ! #5/ 9_7e -* c@€  %!  $ $ $!@@YaȀ??!* @ &  "  . " `. @@a@c @ @^@@?@l aؔ@_ <  "@@@  @@? `@@@0```````````````````````````````<`H`````H````T%s: is a directory%s/%s8 !耢` @k U! !` <   @Q hG !쀢`#P#€  <   @ /  @k$ !`  @   "`2  !€ !ؒ@ܰ 0 usage: %s [-fhns] file1 file2 ln [-fs] file ... directory 㿘P <b(@[?!@4 㿘@fRAIDATAPIvndccdfloppytype 9HP-FLHP-IBST506ESDISCSIold DECMSCPSMDunknownext2fsADFSHFSADOSbootISO9660HPFS4.4LFSMSDOS4.2BSDEighth-Edition4.1BSDSystemVVersion7Version6swapunusedadoscd9660lfsmsdosffsBEFf:NRWb:cdenrs:tvw%srioctl DIOCWLABEL㿈@Lں '7!^)'5 #-+%/9_'쀢 8Z* H@€!$  @& $!$N'!$  @ E$!$!$  @  ':$!$" 6%"⼐ 2$!$  @ )$!$!$  @  $!$'b $b %!$  @  $!$bĐ %b $@@X ??!$*@`&  $!$ b "⼐   !$ "@!$ @` "⤔  `@" !$"`@Հ ?`0*` € @@ @ @z @@o "@ @m @n@] @  `@o0a`@@ R? @RȔ@`@\ ``@! @  4/bĀ . @ʒ`m '` @  ? (`@$`  `@]"@@!@ u @@4|hT 0xunknown disk type: %s㿘@ b0@ @^!&&& `&$@ E DANGER! The disklabel was not found at the correct location!To repair this situation, use `disklabel %s > file' tosave it, then use `disklabel -R %s file' to replace it.A new disklabel is not being installed now.ioctl DIOCSDINFOwriting label to block %lld (0x%qx) lseekwriteioctl DIOCWDINFO㿐" ` @ԋ"!"@Ԇ""@Ԃ#(@#`  !W&&6@bp6bĀ   e`f@   "  i#"`#  aD + 3` @;   aD + 3` @ ;  @1Ā 2H'  @ 6 #' `m@ 6@/ @  #@/ 0%Ā !' `m@e  @/~  "Ā`2  e`g@S  #@J 0 %s: No disk label on disk; use "disklabel -r" to install initial label%s: Label magic number or checksum is wrong! (disklabel or kernel is out of date?)%s: Open partition would move or shrink%s: Labeled partition or 'a' partition must start at beginning of disk㿘 "   0 0@Ӗ"0@Ӓ"0 @ӎ#00@ӊ#X0@W reading label from block %lld, offset %lld disk label corruptedno disklabel found. scanning.no disk labelfound at 0x%lxioctl DIOCRLDINFOioctl DIOCGPDINFOioctl DIOCGDINFO㿘"`t"`  * 2`   :  @@  8 @,  @ "@#c 4 @"`@Ҿ  !W@ @  @ *  b@ !`"   !W !2  2    h@ *  8Ⱂ h (@ې 2 "` `s@+ `@l "`"e`r@ `@[ "e`e@   `@O  @ҩ& Bootstrap doesn't leave room for disk label㿘`( 2 @"&`&`( @!@d !Ԁ@ J c@C *J\ :%.*s|Automatically generated label:\ :dt=%s:unknown%d:se#%u:ns#%u:nt#%u:nc#%u:sc#%u:su#%u:%srm#%d:%sil#%d:%ssk#%d:%scs#%d:%shs#%u:%sts#%u:d%d#%up%c#%u:o%c#%u:t%c=%s:t%c=unknown%d:b%c#%u:f%c#%u:㿘N`` X`` @Vv`N` `` @Vm` h@7`8 ^ * `@V]`(`@VX`(@VS``,@VN``0@VI``4`@VD`8`@V?`<`@V:`H`@V2c`J`@V(c`L`@Vc`Na@Vc`Pa@V c`Ta(@V `\`',8@U,` L ^ `)@975/-+@ 7@UےX= @!@@UՔ`H@UД ` a *@@UĒP ` @UX `  2` ` ,`@< h@U`@Uap`@ ¢` @@[ `*`@R`K   %c: %*u %*u %c: %*.1f%c %*.1f%c %8.8s%8d %5d %5d %5.5s %5d %5d %5d %22.22s # %s # (Cyl. %4d- %uH. `@   b*   /??* : ^@ ` !(!`*` €' ^!0B`('`^!0BD?' ^!0B'`^!0BÉD' ^!0B`8'`^!0B?' ^!0B'`^!0B' ?^!0B?`($@' ^!0B艠?' ?^!0B?@u$' ^!0Bg' ?^!0B?`(@[' ^!0B؉?' ?^!0B?В@B' ^!0B4' ?^!0B?`(@(' ^!0Bȉ?' ?^!0B?@' ^!0BĀ`^!(/ #\aHa@TQ  : #l #\#`#d#haX@TAa  ^ `* ap@T6 ax@T0  ! !@p ## a@d@Ta@T  .ma@Ti `8`d!@!@S@`8  ?`&  @& * *@.?`&  @&  * &@!!`8  @f??@S`8@S  ?`&  @ * ** &@ ?`&  @ ) )* &@ ?`&  * &@ؐ P$ӈX# %s: type: %s type: %d disk: %.*s label: %.*s flags: removable ecc badsectbytes/sector: %ld sectors/track: %ld tracks/cylinder: %ld sectors/cylinder: %ld cylinders: %ld total sectors: %ld rpm: %ld interleave: %ld trackskew: %ld cylinderskew: %ld headswitch: %ld # microseconds track-to-track seek: %ld # microseconds drivedata: %d %d partitions: # %*.*s %*.*s fstype [fsize bsize cpg] sizeoffset㿐"a@R` *^  a@Ra@Rܐ`a@R֔ aȐ @RЖ`a@R̐`X`a@RŐ`X a@R`X a@R ?`&  * & @`(@Rb`,@Rb `0@Rb8`8@RbP`4@Rbh`<@Rbx`H@Rb`J@Rb`L@R|b`N@Rwb`Pb@Rr`Tc@Rmc8@Ri`\`    ,``"`&  4 `', H@RN $, `@REcP ##`ch##\@R4` @    ``@@|w # Notes: # Up to 16 partitions are valid, named from 'a' to 'p'. Partition 'a' is # your root filesystem, 'b' is your swap, and 'c' should cover your whole # disk. Any other partition is free for any use. 'size' and 'offset' are # in 512-byte blocks. fstype should be '4.2BSD', 'swap', or 'none' or some # other values. fsize/bsize/cpg should typically be '1024 8192 16' for a # 4.2BSD filesystem (or '512 4096 16' except on alpha, sun4, amiga, sun3...) No changes.re-edit the label? [y]: ^!@_?@Qc ?@| @| @k @I@s c@Qtc@Qp@I-/+P) !@@ @  ْ@u!br @H@ a`@|?`? "`@L ?  $? ? n%`? $`@Ls  $` 2` n N@+  @ 2`@̎@" sh-cEDITOR/usr/bin/vifailed to start editor%s %sfork/bin/sh㿀chp''#x'@' #@^a@@I  @Q#I c@t' @  @  @ 1  #@j @ &"#@@ @+#@B '@=@  ``@:  @  @  @ 䀠 `? 㿘@j\apL  㿘!p@L   , @jCL  # line %d: syntax errortypeIDEline %d: warning, unknown disk type: %sflagsremovableeccbadsectline %d: bad flag: %sdrivedata%d partitionsline %d: bad # of partitionsdisklabelbytes/sectorline %d: bad %s: %ssectors/tracksectors/cylindertracks/cylindercylinderstotal sectorsrpminterleavetrackskewcylinderskewheadswitchtrack-to-track seekline %d: bad partition name: %sline %d: too few fieldsline %d: bad partition size: %sline %d: bad partition offset: %sline %d: warning, unknown filesystem type: %sline %d: unknown field: %s㻐&`  &`b@А ,$ "@( : "@K ,b0@4q 2 # b8@ ^"^ `<@@ "`@ v `@*@@ '"@@n6`bh@4; :'􀤠3L /-+'#א@4'p  '@4b  '@4∀  'b@ܒ L 0&`Xb@3  &L "`\@',`$  `L `b@ ? "@ʢ 6``6`#b@3Ð  `b@3 `@ b@3 @ 'a"&`(#@n˨ c @3 @ʐ  '#@[ &`,c0@3 @  '#@F &`8cH@3n @  '#@1 &`0cX@3Y @  '#@y w&`4ch@3D @v  '#@d b&`<cx@3/ @a  '#@O  L6`Hc@3 @K  '#@ܒ9  66`Jc@3 @5  '#@ƒ#   6`Lc@2 @  '#@ɰ    6`Nc@2א @   '#@ɚ &`Pc@2 2 @  '#@Ʌ &`T L  *`: `@ `Ȑ#ؐ6`*` @>@Ɛ  ' @X &@#@N %@  ' 0@? $4, ^`` `P@  @ "`@ ``@*@c\  `  @|'$@ : '  X@' ,  "^#YӐ@[ Q$#@H @K@'>, #@ؒ5 @7 -$#@ǒ$ @&@'􀤠, #@ȵ @ 4$@: 6` @Ȥ #@ >@`?sector size %dsectors/track %dtracks/cylinder %dcylinders/unit %dwarning, revolutions/minute %dboot block size %dwarning, boot block size %% sector-size != 0super block size %dwarning, super block size %% sector-size != 0warning, number of partitions (%d) > MAXPARTITIONS (%d)warning, partition %c: size 0, but offset %dwarning, partition %c: size %% cylinder-size != 0warning, partition %c: offset %% cylinder-size != 0this architecture requires partition 'a' to start at sector 0partition %c: offset past end of unitpartition %c: partition extends past end of unitpartition %c: block size < fragment sizewarning, unused partition %c: size %d offset %d㿘 (  # , 2 0  2 4 @ƒ   2 H 8@ǽ   H 2 8 P@Ǵ  8 2 < ,@I 0& 8 < 2  8@A 4& <  p@ǜ  @} ( @Ǔ   @Nj  @l ( @ǂ  `!@{   \)@ 753/-+  a 8@d= @F 8 ,`:`@[h @= 8 ,`:`@Ra2  "    @E!ئ  <@,`:`@<  < ,`:`@1@ 2    ,`:`@%bx @  4, !a  " @ " h`!@jȒ!@eȐ'`LX'P'T7'@Y.! usage: disklabel [-nv] [-r|-cd] [-t] disk%s (read) disklabel [-nv] [-r|-cd] -e disk%s (edit) disklabel [-nv] [-r|-cd] [-f temp] -E disk%.*s (simple editor) disklabel [-nv] [-r]%s -R disk proto (restore) disklabel [-nv] [-r]%s -w disk dtab [id] (write) disklabel [-nv] [-N|-W] disk%s (protect) `disk' may be of the forms: sd0 or /dev/rsd0%c. `dtab' is an entry from %s, see disktab(5) for more info. /etc/disktab`proto' is the output from the read cmd form; -R is powerful. For procedures specific to this architecture see: %s installboot(8)x'b @~@V#a,b@J~bД@Jyc@Jt!#@@A?@Jkc@Jfc@Jac@J\`0 c@JW`h@JQ`@JM`@JG0@}<  (   @*`2 RAIDATAPIvndccdfloppytype 9HP-FLHP-IBST506ESDISCSIold DECMSCPSMDunknownext2fsADFSHFSADOSbootISO9660HPFS4.4LFSMSDOS4.2BSDEighth-Edition4.1BSDSystemVVersion7Version6swapunusedadoscd9660lfsmsdosffsout of memoryYou need to specify a type for this disk.can't run when there is partition overlap.No 'c' partition found, adding one that spans the disk.This platform requires that partition offsets/sizes be on cylinder boundaries. Partition offsets/sizes will be rounded to the nearest cylinder automatically. Initial label editor (enter '?' for help at any prompt)> unable to get default partition tableThis option is not valid when run without the -f flag. PAGER/usr/bin/lesswunable to execute %sIn no change mode, not writing label.No label changes.Write new label?Write the modified label to disk?yunable to write labelRecalculated free space.FilenameName of the file to save label into.cannot open %sNothing to undo!Last change undone.%s expert mode EnteringExitingUnknown option: %c ('?' for help) 'P0@} !P    @M   @M    @M  2c@zC `@,@1((@w$@y@   `8@z(  䀢 2@b h`8$  7$ l'$ , 4 , @b `' z'z 2 7z@b!@`@|!05`@F$@>?   ?`$ `* &`@  q/0/1!@@q @@k @*`:` p=* ÒX@€ #@uȒ!@|X@|T!`@9@6@@V! `@|<!`ِȒ!@|2!@|.@#@U! 2АȒ!@|!@|@v@U! 2uȒ!@|!@|e`r@| @\@V!Ȓ!@{@{!`@ː@Ȓ@<@U! `@{Δ!`3kȒ!@{Đ!@{@ @U! 2bȒ!@{!@{,(@q@Uw! 2IȒ!@{@{!`@v@s@ٔ@UW! `@{y!`` !@a@R@O@<@k "@B  L@ @zU @{ ! L !b@! !^"@{ @C@"@‰@z. "Ā`"(`P@K@T! 5"P@`ݰ %# h@b   `H*  R  y n   H*`@ R` y " @zڔ! @j" @ m@`"4 "b@ L $b@" # @@>@T|! Ȁ` @ @`y#0Ȓ!@z!@z!@z@ "`@k@`_#H"Ā`@`V"(`P@@T?! @`C"P"] @"@zQ!`?``"#p#@ɐ Ȓ@z9!@z5!@L@@#8888888888888888888888888888888888888888888888888888`888888888888 888888888888888888t<8 ,`8888  (8  x  8 T8 8No space left, you need to shrink a partition Partition must be between 'a' and '%c' (excluding 'c'). Partition '%c' exists. Delete it first. partitionThe letter of the new partition, a - p.Partition '%c' already exists. Partition must be between 'a' and '%c'. Please re-enter an offset and size for partition %c. 㻘 ! @a0 N    , Đ!aP@E% p0 `E  `AĐ!@Ea0 -Ā` +Ġ   , @`2  "    a//%)'Ē@D p@-aж N,  ` @ @D!   6 ,     6 & &&& & @ &.  . $  &. 6@ " {&$&@ .   +  ". +      "  +  2  `+ . @[  2N& ϐ@J Đ"H@ a&&@ 28&@c 21&"`" 2@ 2"&@ 2&@ 2&" &┐ @ ? @Cpartition to nameThe letter of the partition to name, a - p.Command aborted Partition '%c' is not in use. You cannot name a filesystem of type %s. 㿘Ő"b@; 2J"@ƒa07*   & Đ!b@C`0&    `Ő!c@Cٔ0 `   * ^a*@ Ő!@CĒc00@partition to modifyThe letter of the partition to modify, a - p.Warning, need %u sectors but there are only %u free. Setting size to %u. Please re-enter an offset and size㿈Ɛ `@ 2J"@La0,`    `' ' '' @&  Đ!b@Cc`0    Ő!c@CU0@ w    `  " ` `      ƒ`А!@C( , &" &@d D@ 2T$ N$@ڔ @]! $ $@ #"`"'   2! @L @   2 @  $$ $ $  b @? @ϐpartition to deleteThe letter of the partition to delete, a - p, or '*'.You may not delete the 'c' partition. The 'c' partition must exist and should span the entire disk. By default it is of type 'unused' and so does not take up any space. 㿘ǐ `@ 2J"@>a0q*!  j" `  " "``""` &"`"`"`"` `0O   .Đ!b@BB`:` `  ` Ő!@B0c(`   @a` b"      ` &" " " " ` .@ @s&@device: %s type: %s disk: %.*s label: %.*s bytes/sector: %ld sectors/track: %ld tracks/cylinder: %ld sectors/cylinder: %ld cylinders: %ld total sectors: %ld free sectors: %u rpm: %ld %d partitions: # %*.*s %*.*s fstype [fsize bsize cpg] sizeoffset㿐".@I# ^!* @A#ǔ  @<#ǔ  @7# (@3# ,@/# 0@+  8@'  4@# 0 <@ @@ X H@ p @ >ϐȠ`#\Ȓ Д@  #a`> 㿐@ b"b" `@@   * @  8? @ ?   + @@  @  #@S    "&@+  "@ @    +  +   `+ &@@rxpartition to change sizeThe letter of the partition to change size, a - p.Partition %c is currently %u sectors in size (%u free). new sizeSize of the partition. You may also say +/- amount for a relative change.Invalid entry Only %u sectors free, you asked for %u 'c' partition may not be larger than the disk 㿐ɐ `8@ 2Jj"   ,Đ!b@@f`0o `  Ő!c@@Z0c@@ p@  ` ` #\`  #`@ڒ??/"2@)! 9 `   # @ ɐ!@@a 0'" &@"@ @ &@ ` < !H@֒a0`b  $@@˔? @㿐@  @"b  @ # `@@qn@"@%s: [%s] 㿘  ʤ X*b'#@_b$@| 2b ` ,b X ?4  " X* $ X @ $ b@tf $L?L ", L ?@Y Lb Lb@#,#Lb ?b%s: [%u] Rounding to nearest cylinder: %u 㻐 8` \@v !/+ʒ@a$@  ` /X ?4  "X* $X @膐 Ӱ?@t ?L@ O ,@O ?O@Y$O ? *`O `tr p`&? @   H*`@ `?* : ` ː!*` € 8 (,@  ($ ( (@u,@O + -   ! '$"@]~" "4?J` $"-? ^' B" '@Đ '^ " 7ā@' B'-:  + -"'`@?> '^"B 8' ^"B^"^B"7ƅB' B' @uŒ"8@u" @u"ʐ!@ ++++++++++++ Error, partitions %c and %c overlap: size offset fstype [fsize bsize cpg]Disable which one? (^D to abort) [%c %c] 㻐@ܒ  0@o @`@ s!` ˑ-`,`@@   `l?l""@2 2``a`a(@@W"P  荚   膚 Ŧ/ˤ -`'%"$* @∠/$@ O X` ?"` X* $ X@ # O` ڐ?*  *  @ @ @oO&`@ -`(2 @@o= Changing device parameters for %s: disk typeWhat kind of disk is this? Usually SCSI, ESDI, ST506, or floppy (use ESDI for IDE).IDE"%s" is not a valid disk type. Valid types are: "%s", label name15 char string that describes this label, usually the disk name.sectors/trackThe Numer of sectors per track.tracks/cylinderThe number of tracks per cylinder.sectors/cylinderThe number of sectors per cylinder (Usually sectors/track * tracks/cylinder).number of cylindersThe total number of cylinders on the disk.total sectorsThe total number of sectors on the disk.You may want to increase the size of the 'c' partition.Not enough free space to shrink by %u sectors (only %u sectors left) rpmThe rotational speed of the disk in revolutions per minute.interleaveThe physical sector interleave, set when formatting. Almost always 1.`!@pʬ@O!^ ;975/ ^*`0 Ғa@ "I@Ȓ!    a  , @ 2  )@'᠐@J` #)̦a%̑, @!؀ @<a`  , a`` ?"`a`* $a`@媐   6 !a 2 "@a0" &@a@"@pZ!0ޒ@G . ')'%# ,#\#` "@PŚ ?〤?@a ,& ,)'%# 0#\#` "p ?ˀ?@ؒa 0& 0)'%# 8#\#` " ??@a 8& 8)'%# 4#\#` #(} ??@娒a 4& 4)'̀ >b <"@ ̐!@;ƒc <#X 4 h@s   4@s #\#`L ?j?2  <!@ta <#Δbˀ @$ @&@@U#b8$b& <)'%# H#\#`    ?"H@L;"x@L8"@L5"@L2#\]]]]]]]]\]]]]]]]]]]]|]]]]]]]]\\\\\]\]]]]]] ]]\|]l],]L]]<]]\]]]㿘'  @ "@@f@ @c $@@c[ @X@ ` "`@cy$@`<@㿘   `" `2 @ ` ``  /dev/%s%s%s%c %s %s rw 1 %d x @f. |   , @ " "@ "    `eآ @  N r ؔ@A$@v / "`N@`r2G ؔ.@$@A`.@@f6?,ܒ @ @b  )  "^ bH|   @*  ` a*@ @#\#\@18  `@ 2@@( Starting sector for this partition.The OpenBSD portion of the disk starts at sector %u, you tried to add a partition at %u. You can use the 'b' command to change the size of the OpenBSD portion. The OpenBSD portion of the disk ends at sector %u, you tried to add a partition at %u. You can use the 'b' command to change the size of the OpenBSD portion. This architecture requires that partition 'a' start at sector 0. 㿐.` ش`خ"!-+)'% ` #\`   #`< @h!% 2a@a! ` " !@0# ` " !@0 ` `!@0yH ` $` Size of the partition.Sorry, there are only %u sectors left The OpenBSD portion of the disk ends at sector %u, you tried to add a partition ending at sector %u. You can use the 'b' command to change the size of the OpenBSD portion. Size may not be larger than %u sectors 㿐.` %%#ـ``2   < 7!H  "N$ " @&E$ِ!@0b  a#\``  #`? ?"@ٶa&  !@٭a " ِ!@/Ӓa  b ِ!@/ƒa $ fragment sizeSize of fs block fragments. Usually 1024 or 512.Zero fragment size implies zero block size㿐.` -+)%'`#\#``, ??"@X @R` 2$`@I{ $` block sizeSize of filesystem blocks. Usually 8192 or 4096.Error: block size must be at least as big as page size (%d). Error: block size must be a multiple of the fragment size. Error: block size must be at least as big as fragment size. 㿐.` ` 9, J "@aC 7)5/-+ @fg@fc#\#`!淪ᰠ?߀?@: @!@. @f (@e bh@ظ! @e,  cpgNumber of filesystem cylinders per group. Usually 16 or 8.㿐.` ۪` )#%   #\#`R ??"@a  24 @xa  FS typeFilesystem type (usually 4.2BSD or swap)Unrecognized filesystem type '%s', treating as 'unknown' FS type (decimal)Filesystem type as a decimal number; usually 7 (4.2BSD) or 1 (swap).㿐.`  ` `(^!*` ې `   , @@ 2 ,` 'ے@!( !,` "@a +)'% ` #\#`ah!Κ ?ꀤ?@ ` ,`  mount pointWhere to mount this filesystem (ie: / /var /usr)noneMount points must start with '/' 㿘. `E A ? = ;.#!ۀ /@ @_@ X *&@c@_V #@@׬a@b#۔#8  "@כa c8@ 2N@  @_Z&@ 㿘 2 @@ 2  2@ `?@Can't stat deviceioctl DIOCGDINFO8@bs? ܒ`@ @2! #ec@^ `r@b 6 &@`e@b 6&@ܒa@Ő &[d]isk, [b]ios, or [u]ser geometryEnter 'd' to use the geometry based on what the disk itself thinks it is, 'b' to use what the BIOS says,or 'u' to use the geometry that was found on in the label.dBIOS geometry not defined. Note: user geometry is the same as disk geometry. You must enter either 'd', 'b', or 'u'. 㿘  ܐ!ȒaH 2 g"?* : `3dݐ!$*` €2(U"& (,& ,0& 04& 48& 8<Q& <`2`(B"& (`,& ,`0& 0`4& 4`8& 8`<>& <2(/"`& (,& ,0& 04& 48& 8<*& <(`(@%,`,@ 0`0@4`4@8`8@<`<@ "@ma0"@gasusuuuuuuuuuuuuuuuut,uuuuuuuuuuuususuuuuuuuuuuuuuuuut,㿘 " " " "   <& 㿘@9ŔFailed open to read on %sFailed open to write on %sFailed open to read/write on %sFailed chdir to %sFailed stat on %sCannot write an archive on top of a directory %s`p"?"r@Vr lpp?_ $"" "`# d" Ѐr#bߐ!( € ݐ"X_"a$" @;ϔ!  $" "ݔ`@I "R_!,`N @ K"  ݐ" _"a$"&@;!  $" "ݔ@I֐ " $"+_!,`' @t $"  ݐ" _"a$" @;! $" "ݔ@I  "ݐ"_p """ ?1_! "@yn  "!@I  p"@`I 6   "_!ݔ@I "< @ _!ݒc@ID "@Uװ??$"$Ѐ@2 "a@`M   @" $  @UĖ ?2 $2 $ "`2$ `2$ l  `_!Dp_p "`"bs#!<iߐ!*` €c? l  `p_!Dp_"#`Z"a<`p @>c? !__"!<_"a< l !_ p!<p>"#`?;"c` l _!_!D  : `p@ 0@_%!D_?"!<%p1p>$!<!<  : `p@u 0@!<  l $!< l ?!< &#`&#`"p_"c`"<%p $Ȱ |{X{X{P{XwwxTxyT%s: Waiting for tape drive close to complete...done. %s: unknown format, %qu bytes skipped. cpio%qu blocks tar%s: %s vol %d, %lu files, %qu bytes read, %qu bytes written. 㿀pb   _"! "``"d_a| # p"`#p_!h`'r?`" * " @Ӈ _!@*3a0@T#pbЀ  p@_ r <   r 4 0 r_@c.a$br l`_!` !p"Ԁ @]( "Ԓ@h @T!|`p"`2 !r @!`_ @T"ah `?$d _r p"``"dpbĐ "b!| __f"! !h`'r?`" * " @  $!h`p !___!aah@)@Tj_>"a !@! _ ሢa ሔ _` @%_ @)0!@g! %_`p_!p_bĒa`? #\#`#d@)p#h@T,$ ?cp"`pbȀ   %p#?@T? 4$ȁUnable to truncate archive file㿘p"p"b̀ 1p"  @SΒ    "@     "8@GN ?Cannot append to an archive obtained from a pipe.Cannot append, device record size %d does not support %s spec㿘p"`b@F ? Ѐ` __!<!c@F ? Failed read on archive volume %dEnd of archive volume %d reached㿘p"Ȁ 3p" pb@Sx _<  "" `!"<" b@Sf  "`` $" p""Ĕ@Fʐ 0p"c@F Write failed, archive is write protected.Unable to append, trailer re-write failed. Quitting.Failed write to archive volume: %dWARNING: partial archive write. Archive MAY BE FLAWEDWARNING: partial archive write. Archive IS FLAWED㿘p"Ȁ pb @S  p"``"6$"$"p" @ & : !b  @RÒ .  > b b@ $  $"Ȁ  "?倢` E0  "  a@F $"C    $"Ȱ p " "``̀  a8@E 0' p"c@Eې 0 r p""Ĕp@E 0 p``"@B a@E 0a@E Cannot allow updates to an archive with flaws.Unable to recover from an archive read failure.Attempting to recover from an archive read failure.㿐 h`g?pbȀ b r`l? W`h ` "`dp" 4=# `9  # `2$pb7  a'@\w 6&$%Ȁ # `b %p"%p  @Q  > @ @ d@Qܖ   $# `Ȁ `@E1  `@E+ ?Foward positioning operation on archive failed㿘  >2@ `(= p"Ȁ 4p5"`21 !p"  @Q    p@ 0C 4 p2 > 4(>p0@ b >0  "@Q    " @E?$bȰ?Reverse positioning on pipes is not supported.Unable to obtain current archive byte offsetReverse position on previous volume.Unable to seek archive backwardsTape drive unable to backspace requested amountUnable to backspace tape %d blocks.㿐p"Ȁ 6p" K  { `(y$Ȑ @Dx`p? !pn `(l$"  @Q    " @D0X?b p"Ā` @DQ``I?    "@P B  " @Dm7?@r 1_ "!<0 `(.$Ȣ :`@@ @D#`? 7@Lp' a@[+    " @D7?$?$Ȱ Unable to locate tape filemark.Unable to backspace over tape filemark.Unable to backspace over last tape block.Cannot determine archive tape blocksize.Unable to backspace tape over %d pad blocks?cp"Ȫ `'p?c⼒ @Pt? 4   "P@Cݐ }?  7'!  @Z!    "p@CȐ h?7'⼒!@Z  ? "@C W?#⼒@P;?   "@C F?@P-? 4   "P@C 6? 7'# a@Zv   "p@C #?!%bȐ@@) `@CH ? 7@L6'⼒a@ZT   "@Ca ?Unable to set signal maskUnable to restore signal mask ATTENTION! %s archive volume change required. %s ready for archive tape volume: %d Load the NEXT TAPE on the tape drive%s ready for archive volume: %d Load the NEXT STORAGE MEDIA (if required) and make sure it is WRITE ENABLED. Type "y" to continue, "." to quit %s, or "s" to switch to new device. If you cannot change storage media, type "s" Is the device ready and online? > .Quitting %s! %s unknown command, try again Cannot re-open %s, try again Switching to a different archive Ready for archive volume: %d Input archive name or "." to quit %s. Archive name > Empty file name, try again ..Illegal file name: .. try again File name too long, try again Cannot save archive name.Cannot open %s, try again 㳈_al @W”  "@Bt  @W   "@Be `h  p"̀`_ @ ! @A"_ @ b a@ bX {p" w u  p"a@Aؐ#@AՐ#( r"a@Aΐ#P@Aː#xr`l?  @A# ; $" @A#;75/9p!+3')@Ac@A@A(@AP@A, @`x  O ?%h`@A'"_"!h`O 2 `Y `s`S 0 `y a a@Aw@As ' @Anp"@Ag '!!@A`@A]@A[!@@Aj, `x@m O p? %h@AF#"_8"!h 2@A=!Pap@S @A3!x@X:,@A*!Q !p"؀ @Ta$"@ X$ap? "%ha@A; ?could not pipecould not fork-c-dccould not exec㿐@|u bp@ @q5p`""b@t @zВ0@z̒@M@M0" @z’ @z  b@z @z b@M@M@{ b@D ?#p@x@ \r p`D T`p`  N_!|` @  E@  @@F  x %@ (`p@,Ð #`p@1 @,G `p@- `p2@` @B `p`(_al @U *@+Cannot chdir to %sCan't fchdir to starting directory?#p@@ r p`D `p`  @9 _!`@6~ @А f/_@1;  x @#_at ?_!X`8?#@2( 0at _aX 8 #@ ( xq@aX  ? `@(  `` `8 V`@+ `p@,א `p _@4 x E@a4  _!8`B_?#@1Ԓ 9_a4 _!8`8 +_@ ( %_x@a4  ? `@( `8  _`@`x @ @B0!|  r @ r @_ "ah  "  "@oz    `@?   6 4? @@А x @ @ @xB`|@4| n_!h`jr  `?"`@* "@@ʐ Y$!h@ `p x @ @ @KB@3ې0F? < @| `_!h`r  `?"`@* "@@Y $!h`2 ?# x @ @B     _@Qa  "x@?  @ `p@* `p`(l @T@ t@8@*=Unable to open %s to read㿈r p?`'@2 @   p`,  p_` 0@4 @$ /_5_@$@2ϐ       @0s  ' " @>@0@+U @ɒ@3` _!$` @  _@@3 0_!|  r @ː _r @ _ "ah_ `ŀ" @|` a| _!h`r  `?"`@* "@@p $ah@t0H p @ @ha|  _!h`r  `?"`@* "@@H $ah 6耢   @耢 ( x`  ` x @ `@A `@. _!t?+'@3T $` p`4@Kl @S Rp @6@cCannot mix current archive format %s with %s%s: Reading archive to position at the end...done. r p?cp@    p `@=m 0w p`D q p`  k_at  @2 b p _@49 X_a|   r`_@Ma_ "ah x at  @2ϐ " p@4)  @1  p@.  @;B  p`(@2 @# |  !_!h r @Ԑ!8$!h; _!t`@2 @@ r p`D ?#p@ directory name is too long %sCannot access destination directory %sDestination is not a directory %sDestination pathname too long %s?b?@?#@_? ' Ḣ @T,l ?L+ /?a&`#@M / /*@-`,"a@.   "a @< 0I<  a`H@@0 :@r 5@5  0_!`@2 '@B5_0'??'@-D  #_at 2 _!X`; * :  /`? @`p@<( 0@.% !-at _aX  8 @ aX  @ 8 @@0A ɒl@( Ēl?c @* _a4  _!8`(_@- 2"_!4 _!8` 8 _@ !4  @ 8 _a|   r @_ "ah_ _!`" @, @G !| f_!h`br  `?R"`0U   ? @ @ !|@02!|  @-l ?b  ' " @;@0 @% 6@@00"@@Y@!| _!h`r  `?"`@* "@@Ɠ $!h@ l @P @4v@Premature end of file on archive readArchive I/O error, cannot continueArchive I/O error. Trying to recover.Unable to append, archive header flawInvalid header, starting valid header search.㿐r p`ض ? ' 5-r19 "b?  @ `P l A @:ʒ# @䀥 `p $€ #`p` ``8 % ` l  @:#P `@I' Ӑ` "_`8@ _0b+ ?c(@: ?a   "a Cannot identify format. Searching...Sorry, unable to determine archive format.㿘q#X"` q!*` * & 6@ o?@r* @*`@"p@Yc `غ " 9r7퀦 T@ N"  ` l K? @: h @ 4q cX@ q!qcX آ@*` *  . `@  2  l ? @9h  @Hs""@Ơ"`¤ a@9ې ?Write block size of %d too large, maximium is: %dWrite block size of %d is not a %d byte multipleWrite block size of %d larger than POSIX max %d, archive may not be portable㿘_aD  _ ؠ "`r p`&!D!D? c  !`(   "" ``  @9~?0_ap_"`s"a<      ?_!D  @__8`"`#  Write block size %d too large, maximium is: %dWrite block size %d is not a %d byte multiple㿘r l _`ذ" _!D? a b "@9)?0_"a  _ _?a<_ __  # :#`ܰ  ?__p "!<"c`Cannot append to an archive that may have flaws.Unable to rewrite archive trailer, cannot append.㿘_!`cH _D  __!<p"D "c`<p"#`  s__   " c`  @ :; F@ @|  @c` :@ D E@d _( ؀`% جc`@$@ % < - ܐ $ؔ"  : c` $% c`$@ % _a_@c`b  %<;a&8`  r "`l c @8V?Unable to append when there are archive read errors.Archive read error limit (%d) reached㿘p#d`L r l`b@8+ C? !_ _7?_ ;   ؔB@ __" 8"`(   :!_#p  :  4c` d   b@@7 0^   _?㿘_`" "`@N㿐  p?_`_ " :   2 @    ದ@fU% _!< :`@ x @ ݖ@r  :?_@ f @ B D (8.  "@:`   ` @:   2@    d% `  㿘#__``؀ !_ ܐ "@M  pc`@$`㿘`$" '_#_%p`"@  @@` @?`@M_`&@@$`` 㿘`$'_#_`"@  @N &@ `@M5`&@$` 㿘' _ "  p@ec` &!?< 2 @ @Mw ದ@ < f $ _`_ Read fault on %sFile changed size during read %sFailed stat on %sFile %s was modified during copy to archive8 H@' _ "  p@c` &G>: 2 @  @CF  ࢤ@ :d $ 4_`8_   "  `(@6i !>@MP   "P@6 >?8 `h@6I > Unable to obtain block size for file %sActual crc does not match expected crc %s( H@  '@M "  ؀ 2   O> "@ @6?  >'/_0-_ :2 @   #\@ _!$` :_   #  : $  @ d ` "@%_@ Ē   H`4   `@ 4 _` !$ _?!$`2   @bh @5  Failed write during copy of %s to %sFile %s changed size during copy to %sFailed stat of %sFile %s was modified during copy to %s(HP  * 2`  *` '     "2  @   @L=  ؀ 2  '"@ @5p'#_'p`ؐ@A #\@ <@ E`ؐ@A` 怦!   @5C 0 H    @   a  @5 @K   8  H@5!   a` @4   H`4 `@㿘pch  )  $h% #_ !pl _  :`#` __ "a? `ؑ> B@__" 8"`User specified archive volume byte limit reached.㿘_!H!H ` 4+_  1%__!`!`!H  !H'%_ @3'p`@4o   p  _ =a`i"#`_ ؔ  _ "`܀@=a`] && %_'p  =a` M`_؀ "`&& ``@ `a` <`B=a` _ ܔ@JV_` &"`$ _ " a`ؚ@ <`C &!_=a`@J9$ r`p @$ @0ߒ __ "a?Unable to allocate memory for user id cache table㿘!p#  1p#Ā 2?!=@  $#  # &#Ēcp@3ѐ ?Unable to allocate memory for group id cache table㿘!p#  1p#Ȁ 2? @ؒ  $#  # &#Ȓ`@3 ?Unable to allocate memory for user name cache table㿘!p#  1p#̀ 2?!=@  $#  # &#̒`@3} ?Unable to allocate memory for group name cache table㿘!p#  1p#Ѐ 2?!=@  $#  # &#Вah@3R ?%lu㿘p#`Y >1!=@Lߐ#* @ "!p`$!p $2 !p`28 `2'13 #  @` #`$# @F (@   &  & $@%A `21"2& $  @  &㿘p#`+ >1 @L#* @ "!p`$!p $2 !p`28 `2'13 #  @W #`$# @F@ (@   &  & $@$ `21"2& $  @Y  &㿘@Iu "[?N Vpc   &N?@,&!=㼑* @ #p  @e  #p 7?! $c  @ c`$c  @,!=@Eܐ (㼡, "@  @ ?` &@ @ @  $` $ $&@ $?㿘@I "[?N Vpc   &N?@+Ŕ * @ #p  @  #p 7?! $c  @ c`$c  @+ @E{ (, "@  @ ?` &@ @ @ݐ  $` $ $&@ $?㿘@%TRAILER!!!㿘`@   ? H`@  ?㿘 <    < & +& $")40,H'H#"H(0  #&  &  &  &  &  & H   o @6 &  <@% ? %?p#` @G $``" 4 ` $` ` r`t` p$$, $ 4 0@Cpio file name length %d is out of rangeCpio file name in header is corrupted㿘lb@1 ? 2 L 2N   b@1 ?Cpio link name length is invalid: %quCpio link name read errorCpio link name is corrupt㿘 H   @   4!  H H@ @0ʒc`? H,   @"&, c,@ N,  c@0 ?070707㿘`K `@   ?㿘 L h! x   :` @  & `  @  & ` @  6` @  $& ` @  (& `$ @  "6 `* @  ,& `0 @  @&  H 8&  0& `A@E : `;@Ӕ ` &0 < (  @ &,., W z?  W㿘@'File is too large for cpio format %sUnable to write cpio header for %sUnable to write cpio link name for %sCpio header field is too small to store file %sHc@'\ ư?``x   :`,& ",    A4  #`H  A @  `b A @~  !ǒ @u  ~#`   @k  t`   @b  k`    @Y  b`$   @P  Y`(   @G  P`"   $@>  G`,   *@5  >`8   0@,  5 ; @$  -  L  `  ``b     2 ,, 6 `c@/6  ? c0@/.  070701㿘`m b@   ?070702㿘`m b@   ?㿘_ @#,"a$㿘_!$` n ђ n #`x  :` @ k `& ` @ e ` 6` @ _ `$& ` @ Y `(& `. @ S `@& `8& `0& `6 @  `H:`& @ B `"6 `> @ < `F @ 7 !?# @ `*  * `& `N @ ' `V @ "  @ `*  , `,& `f @  `&`^ @   ??&j 8 n ` "  .< (  @   @  b  `:&,., |   @  b v ` ?  |㿘_ @%("a$File is too large for sv4cpio format %sCould not write sv4cpio header for %sCould not write sv4cpio link name for %sSv4cpio header field is too small for file %s(?@%q? #?` ``,&_!$`!’ @   `   ! @     @   ` "(`x  (x% #x#`H   `  b `x ;@ 6 @   `Òb`,   ;x   ;@ 6 @ `  %   @ V      @ M  $   @ D  (   @ ;  8   .@ 2  "   &@ )  v `  >@   l'? @ `2 @ F @   _, `  N@   U V  2  @   I ^ @   Aݒ n  ؒ   n  $   "b    # 2! ,, & , $   6 b@,  ? b@,  ` (:`((!Dž0: 2`(0 ?_耠   ?㿘ڒ  _ ! x   S;` `*  & ` `*`@& ` `* 6 `  $`*`@& `  (` *  & `  "` *` 6 ` ,`*`@& ` 8`*  & `* `*`@  & ` H`*  :`*`+ 2 *  @ :`R`` `*  & ` `*`@& ` `* 6 ` $` *`@& `  (` *  & `  "` *` 6 ` ,`*`@& ` 8`*  & `* `*`@  & ` H`*  ;`*`+ 2 *  @ :``*#`8`@`0& `B&& :` ! 3` < @ (@ `H   &,.,   `  b`x ;   @  b  ` ?   &File is too large for bcpio format %sCould not write bcpio header for %sCould not write bcpio link name for %sBcpio header field is too small for file %sx?c@" !D?  ?  ,& ؀ J  `x] [x  H * 2` * 2` `@  c * 2`  x  ` `+=  `-5@ *   - @ (`(`(`(``-) ``, x; ;  , ; *  ` **   : .`.`.`.` )x   :(`(`(`(`)  q :  *   ǀ(@(`(`(`  2 *   (`(`  *`2`*  2`@(`(` $ 2 *   (`(`  ( 2 *   (` |(`  " *`2`*  2`@(` n(`  , : *   (`a(` 8: ::*` @ `*  * (`(`(`J(`<  *` @ (` ?(`9  3    |   "`    $ 2" ,,   , "  Z 6  `@*P  ? `@*G  Unable to create %s㿘%   c*`.@.4` 6*@ސ !?!  b ( $ @  @@*A  ?&@4 &_Unable to close file descriptor on %s㿘`@ @6  _ "8 @* _!`  ( $ @Z _ax  `x`  36 x  @ r t`r x` 08  @ Unable to link to %s from %sA hard link to the directory %s is not allowed8, @   " p@) ?<   @g `@) ?㿘`    @P  Unable to copy %s, file would overwrite itself8 @[ _!`  2    a@)?   Unable to link file %s to itselfUnable to remove %sCould not link to %s from %s8@  >% _!`2Q @@`@ bh@) @?<   @&ߐ %   @D % +  "@) "?@) ?#_  ` @`   @f) a tarcannot follow symlink %s in chain for %s%s skipped. Sockets cannot be copied or extracted%s has an unknown file type, skippingCould not create: %scpioCould not access %s (stat)8  c   ` Z!*` €"H @( +?_!@Z @ ,_!@`, @?%#?" ,@Y < ( ,2`@T 2' &,*  2`@c,2`@ `x, @_~ `@(# ?$ !"  @ɐ ``_!`  $ ( @ ؖ@(, ?_!`` $( @ ( @_ `t_ax  !x  36 !x  @%`J)r_!@ B@Ē  *!x@  " @'ؖ *`2`@u0  c@pa!x  6@>u @  )r   t r x`  t@>` @   t 2r x`"  08 @  @HxUnable to remove directory %sCould not unlink %s8@O !_!`2&?<  @% 6 `  " @BR    "@'Q ?8L /? " /!` @@  6,@ 2 , c@Βa$@ , @ / ,@ @! _,?Unable to obtain file stats %sAccess/modification time set failed on: %s8q X" X%$ 3r`t r x``X@  `t r$`Xr x` `X $ "А @&Ж`X@bq  "@&Đ paxUnable to set file uid/gid of %s㿘@9 6 _!3 @h! b  _!|` b@P 2 ?b@& ?㿘@nu 6 _!3 @A! b  _!|` b@) 2 ?b@&l ?Could not set permissions on %s㿘o@k  "h@&S File seek on %sFailed write to file %s㿘\H% -+ 2 '&"&`"& N  @ `@ L@ "`@ 2'<   @2   Ȑ@2bؖ@& ?2&Failed seek on file %s㿘??@2X   q "0@%ސ 0`h@2m   "ؖ@%А 㿘@ @2/?&@_!p`  0   8  File changed size %sFailed stat on %sFile %s was modified during readFile rewind failed on: %s?c8  `  &a  X @8 :D  ? @  @?@1  #`H `   `a0?#@<  `8` "H  `a`@% ?  @1  ` "@%2 ? & Unable to allocate memory for file name buffer㿘_!@_  "`  "_!P` "_!0` @"q `@8O,_ "`c`@$ǐ ?@ _ ?!p` @? 6 Invalid file name argumentUnable to allocate memory for filename㿘 N `@8  `@$ ?@;g?`$qN /". q`$$  $ $ q` " "`q" "` 㿘q ` "`_!`_ "`_!` ` q q` @3 WARNING! These file names were not selected:%s 㿘_!p` @Fq )'%  4   2 `2 @$""  @)P 2 Can't fchdir to starting directoryCan't chdir to %s㿘q -q@2/$`1 +_%)'`q!_ ,@Ŕ # @ 2/*._ "$  $ +? ` "@_@6a  ""@# ?@S@   " @#?0 !_%`_  @10 $` File system cycle found at %sUnable to read directory %sFile system traversal errorUnable to access %sUnable to read symlink %s㿐_` %q|"`  %q#q@1  $`q а? 8?` 5 ̓*` €_!p`` @ @ ` `0` `@#M 0`  ` @#n 0`  ., `x   ::&,@ : ;` ;` ;` ;`  (;`( 0;`0 8;`8 @;`@ H;`H P;`P X ;`X< "9("140NO``K -0 H?`7:`_!p 2&  8 0@ (`$ " @ & : & , @9, 6 ,`  @" 09&,  & ` @c,`&` & ll l8llTTll%b %e %Y%b %e %H:%M%s%2u %-*.*s %-*.*s %4lu,%4lu %9qu == => 0_!|` @ג?`& * & @@/-0 `@5 _!2  ` ;!@@!!@i` @ @ /`  `H `  #h #`#da #\ @7 ` ? ?` 2   `a8@&`0aH@@`&@  * &@Y @` ?` @̐!P, @S  2 @!X, @G?`& * & @/@.%s%s %s @_!  8;a @K 4!!%8@Ӑ@U @ "/  @ @!r 㿐@8V` N N N @ @f N 2N0@^   J " 0" * 1 Є *`(8*`8( Ʉ*`8(  0(Ѕ8   J`/ `7$(@    8W0*2   0*2    0* :* ? 㿘@  @ O@ "`0"`A@I@Є  2`.* >а*`>@F.> +.>2`* ` >F *`@`@*@2`* >а*`@>F`@ O@/@7$. 㿘@  (  `0 8W.W.* 2`@2   * 2` ` 02 .   0.:. ? %s: unknown option %c %s: %c argument missing 㿘_!  "b`4`I?"J@ -_ a *a "c_J!`@3 . :  ""'?@c  :2J @!ah :2. 㰀 @!a@,  ?*@$"㰱. > ustartarsv4crcsv4cpiocpiobcpiopax㿘@@j  /_`"!`@$!!@# @0!@ؐ# @0#0$!@Wab:cdf:iklno:p:rs:tuvwx:zB:DE:G:HLPT:U:XYZInvalid block size %sInvalid -p string: %cUnknown -x format: %spax: Known -x formats are: %s gzipInvalid write limit %sWrite limit is not a %d byte multiplenoneError count value must be positiveDestination directory was not suppliedP  5O-r`8J  *` €E# b@!_$!D`=b`@m @5_ "a(/_ "a* "_"a$_ "a _ "a@_ "a_ "a b@  0 "-* : `  *` €r" t __rr" x""x# tr" x_  "a_  "axL`(@ @l L  ӤѤ @ b ɤ_ "!pä _ "!t _  "!| @! "q!'!8 @ʖ Hr "`p"`@@ѐ   X@a '+@!@Вx  `H!@`0P _"a,! @"_:HH H"  aH`@ @aH a ` @"@]_ "!XW ! " @r Ѐ p?J"cd@"p D"cd`@u 0 @Db 7_ "!P1 _  "!@+ _@"!@&  @b  @b _ "!0 _ "!4  _ "!8 @@??B  sې!`r"` !%lqȐ   @@  !  @  ! " %l @a@S@Z ll `q#r"`pl`A  *` €!!#7# *@ @ #@6# $#0&#@a@ʐ @%?. @_"a#p# *@ #@# $#p"#d''(D(D(""""""""""""""""$t&l%% &l%%&l&l&l%&l&l&l%&l&l&l%&&l&l&$&<&T&l&l&l&l&l&l!`!h!!&l!&l&l!&l""&l"("<"\&l#0#8#X#p###&l$`b:cef:hmopqruts:vwxzBC:HI:LOPXZ014578write_opt=nodirUnable to allocate space for option listcompress/dev/rst0/dev/rst1/dev/rst4/dev/rst5/dev/rst7/dev/rst8The -O/-o options are only valid when writing an archive-I-rUnable to open file '%s' for readProblem with file '%s'-CTAPE㿐r " |'    )r7 ;r`J #ؓ*` €# b@!_` $!Db`@ܐ @!D* $!D % lp"#d  bJ@ -2 J` _"! '_"!'r}" x @t" w @s  __"am"x_ i"a f% l @+b a@w]Z% l_a| U"a|_ Q"a r" xL% l0  "_D"a_ @"aP@07-`     @nb@1o  b_,"?'"?_ #"a@!' |_ "a0 "@_"a, "P  "`  "p " " "_"a@ϔ؀?I? *`@ &  l 2!!`'` l?   l?@1  l?  rq" "`pq# "`p b@ @ l   y_ -_; 9 7 T5 ` 7 @ْ ) !@wc !_ #@ܔ@ !_@  @@M "@ⷐ !@c! ! @0@@@⤒H 2 @`@ )`% `@` 6 @@  @@~  `@ 2`_"!! p+p  k+p@Vh` D В  ! @F! @R" ! c@ !_ c @S@. !_ @%@Đ "@. !@ڐ! ( c0@4 @! @@cH 2@`@ ".%cd`  @  y` @@  @@b  `@ %cd !_! " J  @0#P $!J  "P$!.. .P.P..$.P.0.<.P.P.P.P.P.P.P.P.P.X-<.P.P.P.P-P-`.P.P-.P.P,-.P.P.P.P.P.P.P-.P-.P.P.P.P.P.P.P++.P,,.P-.P.P.P.P,`.P,l,,,,,,,- -.P-0/%s8 !% + @p@QL `?,@  b @ z! @j ?<   @  ?` /,`ϐ abcdfiklmoprstuvzABC:E:F:H:I:LO:SZ6Unknown -H format: %scpio: Known -H formats are:Problem while reading stdinP __!_r__r?_#$!x "l"a#a"x#!     / 9`D#T*` €_ "apq!&!_ "a( %`l_ "a &xq" r"`p%`l %`l_ "a!`r"`%`l&_ "a|w  ~%`l_z"aD @b_t"aD!  "@[c  %_ "c@ @%_@ @5 @P`V" c0@ @O bJ - J "B%"?%! "q!'!8 @x Hr /"`p" b8@   "P@Va %)@@x  `H@H @_ "a@ "@_ "a,q!r"`p@@?@?#`l* `G@#@*` €@ ? @~` 6@@y@ 2@01@  _a@. @j@_"a `@a@ p@[p"#d%_!x @!    bp@  @F@D:4:4:::x9999999999977898 898899999899999999999999999797,7897@997P997\7l97x79797779997%s: Invalid combination of options: -%c㿘_!!`h@!  q!J 6 `@!@ 2@ !`?"`! * $!@ 㿘@o@q᠀   ᠁These format options are not supported %s = %s 㿘q!`ax@` !1!@e! 2@ Invalid option nameInvalid options format㿘 N  b@ֳ  b@1 :?b( b@) @+ΐ0?L@ ", 'q@G , 2,@A = @+ 䀤,"@ "`"` q "" `$L@ ې 㿐 @F)  "a 2\ `(Y "V J k" m b /J w)J4`,  ,` 4`,  ,` 4` ,  ,`4`,  ,`& @8"  'J`x 4 ``*2   @Z @  㿐@’  _2  J?` '@*  @-@*_ "a  usage: pax [-cdnvz] [-E limit] [-f archive] [-s replstr] ... [-U user] ... [-G group] ... [-T [from_date][,to_date]] ... [pattern ...] pax -r [-cdiknuvzDYZ] [-E limit] [-f archive] [-o options] ... [-p string] ... [-s replstr] ... [-U user] ... [-G group] ... [pattern ...] pax -w [-dituvzHLPX] [-b blocksize] [ [-a] [-f archive] ] [-x format] [-B bytes] [-s replstr] ... [-o options] ... [-U user] ...[-T [from_date][,to_date][/[c][m]]] ... [file ...] pax -r -w [-diklntuvDHLPXYZ] [-p string] ... [-s replstr] ... [-U user] ... [-G group] ... [file ...] directory 㿘!!@x!@t"%0@o#bP@j@f"p@b"@^"@Z"@V#@S@O#(@K#8@G#h@C#@?#@<#cؒ@7@3 @/ @+ @@' h@$ @ @+G usage: tar [-]{crtux}[-befhmopqsvwzHLOPXZ014578] [blocksize] [archive] [replstr] [-C directory] [-I file] [file ...] 㿘!!@"@"@@+ usage: cpio -o [-aABcLvVzZ] [-C bytes] [-H format] [-O archive] [-F archive] < name-list [> archive] cpio -i [-bBcdfmnrsStuvVzZ6] [-C bytes] [-E file] [-H format] [-I archive] [-F archive] [pattern...] [< archive] cpio -p [-adlLmuvV] destination-directory < name-list 㿘!!@"@#8@#p@# @@* Empty replacement stringInvalid replacement string %sUnable to allocate memory for replacement string%s while compiling regular expression %sInvalid replacement string option %s㻘 N ` `L@` `\*`: @2``g`@(Ӑ  `@L t?,@@* @+$a @8 @(ݐ^?`,@ J \2N22 *@5 @(Ð*`$ $J + !*:  P" g G" 0  p"0 $ $@5| @(,@!P@ ?J  qc $qcİ " "cq"#"c Empty pattern stringUnable to allocate memory for pattern string㿘 N  c@(8  `@ ?$@+$ q$ $ `$ $ qc " "cq"#" WARNING! These patterns were not matched:%s 㿘q#  )'%  2 `2 @x  @   2 Pattern select out of memoryPattern list inconsistant㿘q#`  _!`   \$  _W !`22# 2 *`2)#2*@ҭ   $a@+  ` /*@6$  ` /*@$ @*?$ J / * $ $ & #       2    @'" &a@ ?㿘qc  &_!`/_!(`4?2   #_@.         J@ /2 @1 2  a(a(`? `&  T &?& 㿘&N ?  [  **`:N@-*`6N@N@ _!`2/1?&. N@ ߲`(? N *`"   N@Δ `N@ ?N@` `@ 2N?:  `?J!`?   82J! -(J  ] 4  @$  (8 "   ](  Removing leading / from absolute path names in the archive㿘r |`! N  /|N    . .  @)@!&|   $|b@ | )qN, /%q `qN, 2,  . ., , @)@!b,&,| 4 q $|b@ɐ q#` @B  )     _, ,@2 _!`@j     ,, @ T, ATTENTION: %s interactive file rename operation. Input new name, or a "." to keep the old name, or a "return" to skip this file. Input > ..Try again, illegal file name: .. Try again, file name too long Skipping file. Processing continues, name unchanged. Processing continues, name changed to: %s 㳐_!@ !-+)'#!e@8@ah@!@ , %@᠀ @a0@(,O@!0〢  .@!!  O  @Ր" ?"(@Β @_@ϫ,&`? 㿘 @ ? ` ,, @ ? File name %s/%s, too long㿘N@`/ "@l$&@`@ ?  ?*@  * . ?*@ .  Replacement name error %sReplacement name too long %s >> %s%s >> %s >> %s q?#Pc@PPB X/ @ /\  ,@` @* @!@d 6 @ U@F W d@\"  L  ͐2Ũ>@0,@` @@L  @,@L  $a@ $ OP OP  !a(@ OP!a@@OP  @Ϊ,& 㿘 =:  & \*N / 94 *?Ѐ$, @*:  \2 .N  . ` `  "  '@? @ʔ:&* &.Can't open current working directory.TMPDIR/tmp/Cannot allocate memory for temp file name.can not gzip while appending㿘@ @q _  "a " @_e!@&l L@ !@': '_ %_J?`/"?@#ϐ  $Ta@H Aᘀ T@&jT_"\ /* "\0@w &+@ %r l`#<*` €ϵ*_!,`a8@mr Ҏ _(ᘁ_(^^^_Cpu time limit reached, cleaning up.Signal caught, cleaning up.㿘 __"a| "hcP@ 0cx@ސ dž@ $_!p`@@$Ԑ LC_TIMEUnable to set up signal maskUnable to set up signal handlerh @   ?@  @   ?@ z @   ?@ o @ 2?@ d @%    _"@   _?؄ؔ"!l  '''@$ΐ   Ȁ    @$Ô Z  @$  Ȁ    @$ H  @$  Ȁ    @$ 6  @$  Ȁ    @$ $  @$  Ȁ    @${   'ؐ @$r @$l     "8@5 ?㿘r Ѐ`r@ 2 r Ԁ`r@ 2  r Ȁ`" @B   Unable to allocate memory for user selection tableUnable to find uid for user: %sUser selection table out of memory㿘 "S?N #r`Ѐ   !=@ْ  $`8cN # \N  #" @d: 2 `@ ,?  @ @f!=@(1`Б, @ " 2@!  `` @v ?, "  "" 㿘 $!=@(r`Б* `"  @ 2` `2@ Unable to allocate memory fo group selection tableCannot determine gid for group name: %sGroup selection table out of memory㿘 "S?N #r`Ԁ   !=@E  $`8bN # \N  #" @^ 2 bH@ ,?  @ @^!=@'`ԑ, @ " 2@!i  `bp@  ?, "  "" 㿘 (!=@'tr`ԑ* `"  @ 2` `2@ Empty time range stringImproperly specified time range: %sUnable to allocate memory for time rangeBad option %c with time range %sIllegal lower time range %sIllegal upper time range %sUpper %s and lower %s time overlapTime range format is: [yy[mm[dd[hh]]]]mm[.ss][/[c][m]]㿘  N ``@Wi / "N,@`N & ?А , *: * :  .2`x 2`x @ : J 2 @   `` L@ 2$  *$ L@ & @*:  M"  c C"  L@ m2 L@   $   $ `Ж@  S`L@  @@˄ N$`$ @ 6  ` $ (rL $@~  6   a@ @ y$  $  @ a8@  @ g?r`Ȁ $ r" "`  r`̰ " "`̒a`@  ?rȀ`A@8` "$ #  @ &)  `$   @    @   ` ` `2` `?㿘@~@DŽ . "$@, @#0 2a?L?Г* @L *`В@ `=$@T?@#?`8N?#*` €N?Г* @N *`А@ D$` d$` N?Г* @N *`А@ $`?$` N?Г* @N *`В@`$`  N?Г* @N *`В@`$` N?Г* @N *`В@ `;$`@&@?? oDn<on<nn<nn<ntCannot allocate memory for hard link table㿘1r! 2 )@  &! c@ ɐ ?Hard link table out of memory㿘r!`m%`"`b )@%Ka-  5      @ 2  @ 2  ,@=, ` &,  &  ? $  $@@$ @  @  $``$  `"$  - a $ @ $  "@ @`8@ M ?㿘!r! 8#`"`3` / - +`@$ג)!*  "  2  `   @ 2  @ 2   #@@㿘ra   *@  "@`@@`2Cannot allocate memory for file time tablepaxXXXXXXXXXXUnable to create temporary file: %s㿘1r! 1A !G@  &!c@ Ð 5?_!\# #1_* * * * * * * * * * * * * * @!Tr "a,!T@% 0  "!T@  ?Failed ftime table seekFailed ftime table readFailed write to file time tableFailed seek on file time tableFile time table ran out of memory㳐r!`  1@G- @`;+ -@2&``!r!,  @ ` ` !,b @ f [?@E@ӛ ```2@`  8`  ?$`= @  .!r!,  @  <`!,@ɔ  8-  $`$@ $`" "P "p@   ` "8a@  `?@?Cannot allocate memory for interactive rename table㿘1r! 2 "@  &! c@  ?No interactive rename table, links may fail Cannot update rename tableInteractive rename table out of memory㿘r!``p@  I @,"a, @`0` `@@i 2```@` + @`@ &``@ @ڐ &@@Ր  &`a,   &` " @@@`@ H ?㿘!r! @@ޔ"!* @ @  2  @&@ 2Cannot allocate memory for device mapping table㿘1r! 2 !=@4  &!  b@  ?㿘` @  ? Device map table out of memory㿘r! `-!=@"a , @` `2` " @L  a , ""  "" cx@  Unable to fix truncated inode/device field when storing %sArchive may create improper hard links when extracted㿘r!  ` }  @ 2  " *     +2$`& `W& `R y  B`25r"5r@ې 9"" "$ 5r0  &00\  0 @!S  `h  &0a0 @  a0"" "$  &   &`h @ `@  Cannot allocate space for directory access time table㿘1r!$ 2 !=@$  &!$ b@ ?㿘ra$   $*@       2<$Directory access time reset table ran out of memory㿘r!$`6!=@!c$,`@     2  2  @'  @  $$,`$ $ $ $  $ " @:c@ 㿘!r!$ &!=@!(!$*      "  2  2     "@ & &@ @ 0?Unable to create temporary file for directory times: %s㿘!r!(?2 _!\# #1_* * * * * * * * * * * * * * @]!T  $!(!T a@! ?!T@"@ Unable to store mode and times for directory: %sUnable to store mode and times for created directory: %sxr!( /  @  ? b@ 0"`' !(7'' @'؀  !(@  _a "ac @ɐ Unable to set mode and times for created directoriespra( R  9'_@f >ؖ !( @B 6!( @WЀ .ؖ !( @2 &_!x`쀢 rWr t`r x`߮  !(??@  !(@!(? $!(!`8@b 㿐`@  @6` `   *  `'  * @Ր㿘 -$ $  J" ?`   " @ 2(* * * *( ( 0(2    0( :( ?   @  2*( ( ( (* * + 3` ` 03 *   0*:* ?  !    ustar㿘a$?N "a@!@     Ғ"? ?write_optnodirUnknown tar format -o option/value pair %s=%s%s=%s is the only supported tar format option%s=%s is only supported when writing.㿘-_)"'"+"/"$%"@ !" @Ѐ  r a@#  !`l? 8 @  ? % ۢ! 㿘" !?  &   "6 & @¯,&`d q  / 6`l j  $& `t d  (&  `|ʒ  H :  W` @&     ; 8& 0&  x:N` `1`2,``5"'.,   & `,@k,  (  &  6`,@_,  @ 69&,@  & 6 6., .&,., &,L /`  `"` &  6 6 `H@`  a"@   b  `` & `x6 a : :L /2 ,?& Tar cannot archive a character device %sTar cannot archive a block device %sTar cannot archive a socket %sTar cannot archive a fifo %sLink name too long for tar %sFile name too long for tar %sFile is too large for tar %sTar header field is too small for %s㾐 ` -$"P*` €_!`$%°  #a #b #b0 #bP, d#, bp%   c# b !@f  d@ x :?, /,  2  1,, @k d l   c!H ,lʘ  #Vb" @  b a:!   `d} < $  `lt 3 (  `tk * 8  `b  !!ː` X   !  W  ?       #b@C  ,H`xĝ㿘Ϟ ?  ?㿘< ?a  ?㿘a$?N "a@!@}  2?  ᇔ i"? ?㿘ߒ"  ?# `"6  `& `& &NaY   aY@, /,  , @"&`d O  /` 6 `| ᴒ `H :  A``@& `8& `0& `(.aHa)~ 6`$`t / &`$.a(a  ``l " &``x  ;@ :`,& ., &,N``7m%#,*` €  @ 6 x&     "  &6  6 L /2g &c,N` 4 `  ` `  ` & 6 aI ֔  aQє ?c , *`  ,:&N` 2 `  (` &  6 `   `"` &  6 6 `, @,&,`H@`  a"@   b  6` `x& ` a: : @@H Ustar cannot archive a socket %sLink name too long for ustar %sFile name too long for ustar %sFile is too long for ustar %s00Ustar header field is too small for %s㽠`  `&`    , c&, `8 @ &`X !@'x    :,Y@%  /, @ d ?` E*`'  € 53,` ` 4 3,` , ` aI>  ? @ `2 @aQ 1    6,` ` 1 2,`,  d@ߐ` `|   %" `  0 7,`! H @" a  b  x ;@`| +   &b`x"a@ @a&` @ a!   `d  J $`l ז  A (`t Ζ  8 8  `Ŗ  2/  @ߐa В  @ؐa)! `   a!  ɬ  ?       &`@  |`c`  H /" J J/2 J" `4 ` /dev/ttywrFatal error, cannot open %s㿘'!@M  '@na!r  $!'a@fr  "a@!@ Ԑ_!`' aДa@3 ?㿘!r!'H'L'P'T'X H@@ !㿘` r!@ 2. ?@5 2* %s: 㿘'L'P'T'X L_ "a_!|` !1_!h r@ `!@< &!h_!!'c@@@@-  <%s>㿘'P'T'X P_ "a_!|` 1!_!h r@ `!@ $!h_!!'c@@ῐ@p` !'#@@᱐@ 㿘@icmpunknown protocol icmpsocketDI:LRS:c:dfh:i:l:np:qrs:T:t:vw:bad number of packets to transmit: %s%sbad interface address: %sbad timing interval: %s%s: only root may use interval < 1sbad preload value: %sbad packet size: %spacket size too large: %sbad tos value: %sbad ttl value: %sttl value too large: %sbad maxwait value: %sunknown host: %s-f and -i options are incompatiblemallocbind-R option and -D or -T, or -t to unicast destinations are incompatiblerecord route not valid to multicast destinationsping: record routesetsockopt IP_MULTICAST_LOOPsetsockopt IP_MULTICAST_TTLsetsockopt IP_MULTICAST_IFgetsockoptsetsockoptCannot set the receive buffer sizeCould only allocate a receive buffer of %i bytes (default %i)PING %s (%s): %d data bytes PING %s: %d data bytes ping: recvfrom@  (// @''/ '(`@   @ _ "c,(a@[ @\v @%# @\r%_@%+rrbl Ȕ'T'`'d'h'l'p'X/9r'P'\'t'x'| 3,* @€b @ _ #c4(ba8@А  $/$ @$@\.  !(!`@1 @ `$`@s (b@Ȓ @=b 2 (bah@  / -  -  - "$b@ rⰁ =bxrb r(ba@ " bx@[  bx!(!@ @n rbȁ)=bx $X/ {%X@[ " b!(!`@ʐ @R  @& i((ba@G  _$b@ \$X( S$ O$ K$b @ r`"h(ba@! ?#@9((ba@  $b@ )'(bb@  $b@ؔ /(bb0@ !$b @Ȕ r  "(bb`@ @ (@a??c* & @ @ bxrD#cc""_#’    H`D" @@_ *-`@ђ _"(@< 2 (bx@ -` @L @ה!_#c(  r(b@ "h` _"P` @' (b@Zb  rh @ ,h`@@?c ##c`< 8 _X %X#@"#@ ,_+c@ *" "" @  (b@Z(  @?,c @   ?,c @  <` 8 X %X$ d $ d(b@ %,  @ _#X<* @ *@@ _"cXcX, `4 4 4 , ` $ , $  <` 8  (c@   '///, T @ ( 6X(@#H@Y X , ` @  X(c`@Y X , d @  X(c@Y X ,  @{   (c@Y  ',!?#h#l@b` (c@Yu @1?,#p`@Y  1?(c@Yd ! #("< '"c@YY ,# "@A  "?@4 `)`@Y ` _`_('@X)Hrbh@7 1#()hr@7h1`d@ ,"@ ,@ @2 2,@, 2 * @/  (b@Y |#'  @ ''@., 2 * +  & P  @r  ', \@pt  x ⨀ )@`'@ \@Z @ٔ _#4`_0 @@@X t(84Dd0l|㿘 "@E,b@N _c4_#@  _c @C* $#0` r @1 `" 1r"1`d@* @~$㿘! "@N $"ping: sendtoping: wrote %s %d chars, ret=%d 㿈+rbl -- r"d_ 5 `5 ", 4 5 #c`@: @   @*@_P* ,@ @졐''bl** * * * * **r"h`@_c  5 _#X`5 @5 _c,_# @q  @`6_,@#_#(,#@6  rbq @$ packet too short (%d bytes) from %s%d bytes from %s: icmp_seq=%u ttl=%d time=%d.%03d ms (DUP!) wrong data byte #%d should be 0x%x but was 0x%x %x %d bytes from %s: LSRR: 0.0.0.0 %s (truncated route) (same route) RR: NOP unknown option %xx @ `*`@ _#a !-'!@@W0&@ #@ _0_cP   V"0  / / / / / / //?" "@ ''Вb@ ??r*`" * "* *☪ :@B:☔@vrrb " "B;br(r8r" "1r @"d:1r"d#`@`: L@[ <  _< #0`?"<'#0@K: "d@G   *@ , _#`j`rbp @ y!-'@P!@5-@4"cP`!-"  #@p  @# @4 `-@4"8r"lrh  `E- @ bh@4ΐ"@bh  7)-#-  2 @4"x @4bbh  &  ޒ`_#a  *  @&@ !-@"@4@s#+_)-  "-   - `E "-- @4w"   ` '-#-'`` ?"``* "`@     *   @ *   *  @4I@@4Bb`Ӥz    n_aȀ 'a@r '#  '-@4"ؒ S%'a$aȒ@-$a-@4 " '-#-`'3`` ?"``* "`@     *   @ *   *  @3@?@3ڐbԲ`@3Ӑ"@3ϐ"  `@3ʐ" "  5 #  a``?"`!` * $!`@T @!``  ` `? (?888* 2 --- %s ping statistics --- %ld packets transmitted, %ld packets received, %ld duplicates, -- somebody's printing up packets!%d%% packet lossround-trip min/avg/max/std-dev = %d.%03d/%d.%03d/%d.%03d/%d.%03d ms 㿀!``"@ ` * $`@ @Q` !__#(/@33#!_#0@3. _00 @3( _ c<`0@3  8##0 "0@3 P`*` *  !0 x @L* @3``?"`` * $`@ #0__#P`[<: r@h r@a @@ @Ddr )0  #@L? @ږ#  #@@  #@ΐr  #@2  #@#\ #@&#` #@̴#d @2㿘     (   @@B: 2   B* 2`@ : b`D 8 怢`  㿘 @   _#0 @ `?Echo Reply Destination Net Unreachable Destination Host Unreachable Destination Protocol Unreachable Destination Port Unreachable frag needed and DF set (MTU %d) frag needed and DF set Source Route Failed Network Unknown Host Unknown Source Isolated Dest. Net Administratively Prohibited Dest. Host Administratively Prohibited Destination Net Unreachable for TOS Desination Host Unreachable for TOS Route administratively prohibited Host Precedence Violation Precedence Cutoff Dest Unreachable, Unknown Code: %d Source Quench Redirect NetworkRedirect HostRedirect Type of Service and NetworkRedirect Type of Service and HostRedirect, Unknown Code: %d(New addr: %s) Echo Request Router Discovery Advertisement (%d entries, lifetime %d seconds) Router Discovery Solicitation Time to live exceeded Frag reassembly time exceeded Time exceeded, Unknown Code: %d Parameter problem, required option absent: pointer = 0x%02x Parameter problem: pointer = 0x%02x Timestamp Timestamp Reply Information Request Information Reply Address Mask Request Address Mask Reply (Mask 0x%08x) Unknown ICMP type: %d 㿐`ޓ*`3!l €1@1 0 `O13!,*` €1@1  01@1 01@1 01@0!0 `1@0!(01@0!P01@0!h01@0!01@0!01@0!01@0ސ!01@0ڐ!0{1@0֐"0w1@0Ґ"80s1@0ΐ"`0o1@0ʐ"0k1@0Ɛ"0gd"1@0"0a  " 11"11@0" 1@0# 1@0#   @0#H @0#p !1'#@ސ@0011@0#0M1@0#1 #@0 0D1@0#0@  2 P2@0q 02@0m 00  22 @0d x0  @0_@ 02@0Y 02@0U 02@0Q!02@0M! 02@0I!80 2 @0D!P02@0?!x 0\l|ʌʜʬʼɸ$(p̰Vr HL TOS Len ID Flg off TTL Pro cks Src Dst Data %1x %1x %02x %04x %04x %1x %04x %02x %02x %04x %s %02x㿐3 ` *`@/!3 2` 2`  @/" 8 3?* 2` @/א"  3 "0 @/) !3'"H@@/Ɛ @ '@/` !3 @/"P`!``?"`!` * %!`@J %s (%s)㿐_#` ' @4  2!('!`@ؐ#_a@ !a!3#'@ʐ#_a@!aTCP: from port %u, to port %u (decimal) UDP: from port %u, to port %u (decimal) 㿘j * `  * 4*`@ @/H P0`   * 4*`@ @/9 patterns must be specified as hex digits%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2xPATTERN: 0x (N@ ĠȢ̂ЈԖؘܚ4\  `D`H@ H 2#l;p4#\#`#d#h;x;#ax@R ?#" 8_ @ @ `. @ ( _#`4@.! @ 4#3@.bP`@&4@.!< @2 2 2`((  ``? usage: ping [-DdfLnqRrv] [-c count] [-I ifaddr] [-i wait] [-l preload] [-p pattern] [-s packetsize] [-t ttl] [-w maxwait] host 㿘4c@Կ!@ 㿘@benstuvusage: %s [-benstuv] [-] [file ...] stdout㿘@ƫ5`@. /5%#)!+-1'55-9 8"P* @€ $!$` % $  $` %` %$ !`@gԒ   $ P <5!@h`@] @฀?А?* `@  `  `   @,0@~@Ԑ!` 5`@O @1 \l|ՈՔդոstdin-r%s㿘5b! "+5)5'5% b @a  #@ @O$   %@@˂ 2%6d 㿘   %$`  `` 2   ` `` `5cؐ@Ô `@2 ` `  ``` $?"``` $* $`@| $Ò``+ ``` ^?"``` ^* $`@|Ԑ ^`` I?"`` I` I{* `f`/`` M?"``` M* $`@| Mz`` -?"``` -* $`@| -"e `c\ ` ` /`` ^?"``` ^* $`@|u ^E` ?`@``? "`` *:   ` * ``? "`` ,`:   ` `* $`@|C"  ? & @1  &  @  5@NZ#  " 6 ` `@5`@N 㿘!5R b "+5)5' b @   @ #@N*$ T` %@T` @# 2buffer8Ran#`)+@d  5c@Mϐ d*$ @%c %#7a8@M %5#@@ 6@M @#@ c 4   5@MՐ# "`㿘@H@00 0ttt\pPPxxxp<` XdHd8d(d  : ;4 > ? + + + +7 + B C DHxph` XP@H@ 0 t  <  0Hinstinstance-mediaoptmediaoptmedia-link2link2-link1link1-link0link0deletetunneltunnelgiftunnel-vlandevvlandevvlanEtherIIsnap802.3802.2tr802.2nsellengthsnpaoffsetphaserangevltimepltime-tentativetentative-anycastanycastprefixlenipdstbroadcastpowersavesleep-powersavepowersave-nwkeynwkeynwidmtumetricnetmaskdelete-aliasalias-debugdebug-arparp-trailerstrailersdownupp  2 3 i@i"@"Ph & 6 7 ixi""` ' 9 i@i"P"PX )X < i@i"@"PP ,l = i@i"@"PH 0T >L0iti""hisoipxnsatalkinet6inet-a-A-ma-am-mA-Am-mextra address not accepted'%s' requires argument'%s' requires 2 arguments64encapsulation routingSIOCDIFADDRSIOCAIFADDRH@V   @`9@ax@!? 9E @@a 9 < @@a 9@@ a 9 ,"!@@a 9@@a 9 "! @@a ! ?"a `@@!@@ ?@!@@ ?` 7s)5Ь;9`L"!<@ " !<@@ 2`$$!<?`!<!X ` * &4 $ @] @_@ @!X@p  Ȑ@Q @ ?"p@"t  @ Y)59/97"h`"@@ 2  2 a " $ 9  a@ 4  +? @ ` @ ?`@` "``@ڐ ?`@ !( %!(? `@4  s8 49b@ W 4   >bD7 8bD@=3d -"P  @H  @Dbd "P  @7  @3bĖ  @Q "  9@Jb@#`bD @`@ b`@` s b 19x s9@Jib(s, @` @ b` @` 9@JWb8@ʐ 㿘#s`@?!@S"Đ @ $"Đ?$`@$`@socketSIOCGIFFLAGSSIOCGIFMETRIC㿘s`4"Ā !0;`@I !@ 6V ;@J !?"b@bĒ!@ 6 ;@J "!"!b0a~@ 6 "!P"!P getifaddrs%s: no such interface 㿐@c   ;a@I `~ !@ `@  2p@`@ - ` ` !  @͔!  `"!X!X$ $ $ $ $ $ $ ` @`  @O @` `  `y &B@@  < " ` `@ 25@` ``!<`"*@!<  9` T   @ ` `L `L` T   2 $ @  $ 2` ` ` " @` @J􀤠 ;!a@ؔ@@͐ 㿘  !x`s" " ,""D!<8  2`error in parsing address string: %ssource and destination address families do not matchinvalid sockaddrSIOCSLIFPHYADDRX   2> 2>>"("0@$0@$"8  #>@$b@ &SIOCS80211NWIDh '̠̐В   !!X/Вa@ @bĔ0$ @a怢 >@Fe#`persistpersist:,SIOCS80211NWKEY: too many keys.SIOCS80211NWKEY 'Ԁ''] ? @| ?'Ԑ!'Д?"? 6"H  @|  а !'#\ ` ( N  :$ *: ?'԰  )?| ܲ'|  9|`$$? `` ?@F( 0*'| | !|''آ ` ܑ,`@""@```a@ @bĔ @]a耢??@Eΐ @SIOCG80211POWERSIOCS80211POWER㿀a@ @#b0a@A?b?@E"X0  'a@5??@E"h㿀a@ @Ȑ#b0a@!??@E"X0@z%'b a@??@E"h nwid nwkey *****%d: powersave on (%dms sleep) off!X"!X$  a@ $ $ $ $ $ $ @bİ 0a@ 2 #a`?@s#| ?`$ a` * $a`@s   ???????a@ @Y"0a@   ?a`@sh# @  " " `? "0a@??@【#l      , `"   c\  `   :"    ? @{   ?@"# /? `` ,?"```* $`@r ,@`@r``  ݢ```?"`` * $`@rd   ???a@ @"0a@ ?a`@rϐ#`?@"#0?@#ȁSGIOCGIFMEDIA%s: no link type?p!(`#  ?????a@ @bĔ0 @ޒa6   "`@c@D "!$!$ @c@@/ SIOCSIFMEDIA㿘!(`"#a$bH * !!X$a$a@ @La$b$ 0a5@ A`@C only one `media' command may be issuedmay not issue `media' after `mediaopt' commands㿘!(  AaH@ %Aap@ڐ $ `4`@,`$$only one `mediaopt' command may be issuedmay not issue `mediaopt' after `instance'㿘W!(  Ab@ AbH@ a$@ "bonly one `-mediaopt' command may be issuedmay not issue both `media' and `-mediaopt'㿘%!(  Ab@y Ac@s a$@^ "bHonly one `instance' command may be issuedmust specify `media' before `instance'invalid media instance: %s㿘!(  Ac@A 'Ac@; $?# @ ` `@wא`B`@* *` $$ 0 (@ @ `  IEEE802.11FDDItokenTokenRingetherEthernet   # # # # $ x$ h$ `$ X% P% @% 8% 0& & ' ' ( ( ) ) * * + + , , , - p- h- `. P. H/ 8/ 00 0 1 1 C C D D E E F F c c d xd pe e h ` X P H @ 8DS11DS5DS2DS1FH2FH1CDDIMMFMulti-modeSMFSingle-mode16UTPUTP/16Mbit4UTPUTP/4Mbit16STPDB9/16Mbit4STPDB9/4MbitHPNA1HomePNA11000TX1000baseTX1000CX1000baseCX1000LX1000baseLX10FLFL10baseFL10STPSTP10baseSTP1000SX1000baseSX100T2100baseT2100VG100baseVG100T4100baseT4100FX100baseFX100TX100baseTX10AUIAUI10base5/AUI10base510BNCBNC10base2/BNC10base210UTPUTP10baseT/UTP10baseTnonemanualautoautoselect x p ` X P H @ 0   @ @ @ @ @ @ ` `     ibss-masteribsshostapadhocdasdual-attachALLRAllRoutesSRCRTSourceRoutingETREarlyTokenReleaseloophw-loopbackloopbackflag2flag1flag0hdxhalf-duplexfdxfull-duplexB` @2```2@C#B<`"C  @2` 2```2@C#unknown %s media subtype: %s㿘B!<@F? !D p@ strdupunknown %s media option: %s㿘@   D`@@ #?!@2 ?!D @ # @ @` C@㿘  "?` 2   @w 2   2?%s %s%smedia %smediaopt instance %d㿘`  !D"(D@D"0D"8D"@N@ѐCa  16 %? #D-D+D)?`2  @ @ 2 ` 0HbPb@@0` b@@  @@    26 `D@"`6 physical address inet%s %s --> %s xD"@// "@`a@ @bĔ0@ؒaK , @ !#\! @ڱ `D# @ʐ!#\ @ڜ D#ؒ@G   `  @   x no networkinsertedno ringactiveno carrier%s: flagsUPBROADCASTDEBUGLOOPBACKPOINTOPOINTNOTRAILERSRUNNINGNOARP PROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICAST metric %d mtu %d%s: no media types?mallocSIOCGIFMEDIA media: status: , unknown supported media: p Ea@@ǐ!BEE!@T!`E@"H!P`E@"X a``?"`` * $`@mH @ a@ '  ????? @#0 a6@  E"`@?퀦`@K*  Ebx@?$ a6@' 6EEb@? @k" } @;``?"``` * $`@l ``?"``` (* $`@l ( Q ``?"``` )* $`@lϐ )``?"`` * $`@l 耊 U-E@"E  @ 7   'E )*! DED @2 @2 b0Ⱈ@  ` ` @  *@`2і `E@Ґ"``?"`` * $`@lj  )   @  /E-E+E  2@ @  @b`@ $ݢ @`!< 9 @ 0 L` L!X  ,  € $ 2   inet %s SIOCGIFNETMASKSIOCGIFDSTADDR--> %s netmask 0x%x SIOCGIFBRDADDRbroadcast %s㿀 bĀ    "`+;`@= #!Xa@ @I!G @ ''''@m'@1 @2"0a%@  "`1G@= P$$ $$a" 'b@ . #$ahah$ 0"$ $ a"@e? 6X "`12G$ah$ $ $ @=̐ `Xa@ @`!G p'@m2@ G@ߐ x@`0#$ahah$ 0"$ $ a#@1? 6X "`1G$ah$ $ $ @= Xa@@    '!G @l@``?"`` * "`@kD 㿘!<`€ s "`8`??` *` "`*`  inet6 %sSIOCGIFDSTADDR_IN6 -> %sSIOCGIFNETMASK_IN6 prefixlen %dSIOCGIFAFLAG_IN6 anycast tentative duplicated detached deprecated scopeid 0x%xSIOCGIFALIFETIME_IN6 pltime %s0infty vltime p bĀ    "`+I;`@<Ր    ! #\ ! @j "HD "@/H@ b@؀ H) ! @!@ @ 0H a"' ' ' ' $' (''@T  "`1" H@< 0  ?  ?//?'L !#\! @ "HD "@/H H@Œ ! @!@ @ 0H a%' ' ' ' $' (''@  !H "`1 H@ %d.%d broadcast %d.%d㿈I bĀ    "`+;`@;a !X"!X a@ $ $ $ $ $ $ $ @0a!@ 6!X " 1 /2 I ] $ " " " @;e"!X @@  ?? ` `I " @x b@ # 0a"@Ҕ 6!X "`1G& $ $ $ @;9 `!X@@_  "I "@R b@  !h I "@F ``?"`` * "`@hݐ  ns %s 㿈 bĀ    "`+;`@:ΐ !X"!X a@ $ $ $ $ $ $ $ @0a!@p aX " 1 /2 I c $ " " " @:Ґ"aX !@@` 7 !J7 !P7 7 7 @7@ސb@ .0a"@9 aX "`12G$`& & & @: `aX!@ @Ɛ  !G7  p7 7 7 7 @7@``?"`` * "`@hD 㿘s (" ( "Ā`  "`+;`@:5 !X"!X """ """"a@@p  2"b ipx %s SNAPframe %s X bĀ    "`+;`@:  !X"!X a@ $ $ $ $ $ $ $ @Q0a!@ aX " 1 /2 I  $ " " " @: "aX !@@3` / !K/  H/ / / / / / / / / @/@ b@ :0a"@h aX "`12G$`& & & @9ϐ `aX!@ @  !G/  p/ / / / / / / / / / @/@А '8b '' 8b'8'̐ ''8bK !7'ܔX''''` # " ``` "`@2```K@ `a``?"`a` * $a`@g3 SIOCGIFADDR_ISO iso %s SIOCGIFNETMASK_ISO netmask %s SIOCGIFDSTADDR_ISOh bĀ    "`+;`@9   Ȫ a@?????? @Y"0 a!@  " 1 /2 K g????@9# a@@<!L @ơ@/"0 a%@ 6!L "`1 L  ??? ?@8   0@ƃ@"@`""0 a"@l a@ "`12 L  ????@8ѐ @a@ @!G p@^@``?"`` * "`@f %s: bad value㿐s D.`  `, ,  @m @m @1 0@   #@ @à$ Lb@s 㿘s D.`  @s?   Lb@_ `, ,     @f 0$  * "@  * *%s=%o%s=%x㿘  N  M.`M X@_2M,  `@X2r a``?"``a` <* &a`@e * &a`@e >%s: %sps T.`  ?ؐ ??? 'H'a @?Ԁ  !M@ء"@판 ` "`Lb@탐  @* ? @?@       $ 4 @lZԁ㿘s T.`  @r8  Lb@X `, ,    @_ 0$ $ $ $  * "@  * *      " 2 $ " 0   8 2 `8 씂8 2  &  AppleTalk does not use netmasks%u.%u%s: illegal address㿐 "`*"``,`Nah@ߐ Na@} N` ?#@  (`Na@  4`,`%hu-%hu%s: illegal net range: %u-%u㿐 {77Nb`@N  N@ Nbh@앐 !02 2 12%s: illegal phase㿘Nc@ N *a0c@ N *a0c @m  atalk %d.%d range %d-%d phase %d AppleTalk address is not in range㿘# a0 a0 ,a0  2  4 4  N #  @t a0   8N  Nc@4 a06  6  6 Attempt to set XNS netmask will be ineffectual 㿈s d.`   ,, #@@  耦`4 4 4 4 4 4 O@4 Attempt to set IPX netmask will be ineffectual 㿈s t.`   , ,#@@ s, 逦`, , , , , , , , , , , *4 O@!X㿘s.`  @  @` `  ,,  , ,㿘@jJ"c؁negative NSEL length is absurdsetting NSEL length valid only for iso㿘@j1s "`0Ob@념 !< OR  b@y  s3* 㿘!s    usage: ifconfig [ -m ] [ -a ] [ -A ] [ interface ] [ [af] [ address [ dest_addr ] ] [ up ] [ down ] [ netmask mask ] ] [media media_type] [mediaopt media_option] [ metric n ] [ mtu n ] [ nwid netword_id ] [ tunnel srcaddress dstaddress ] [ deletetunnel ] [ vlan n vlandev interface ] [ arp | -arp ] [ -802.2 | -802.3 | -802.2tr | -snap | -EtherII ] [ link0 | -link0 ] [ link1 | -link1 ] [ link2 | -link2 ] ifconfig [-a | -A | -am | -Am] [ af ] ifconfig -m interface [af] 㿘Oc@m!@b  vlan: %d parent interface: %s 㿀 @ibX0a: @^"?` P!P!@ SIOCGETVLANSIOCSETVLAN㿀@iJ,2 ss ""@iT !X#b0& a:@)?bPb@4j  7a9@?Pb@4_ must specify both vlan tag and device㿀s `Pc`@h @i !X%0a:$`@?Pb@45  @s`7 a9@?Pb@4$ 㿀@h !X%0a:$`@̔? Pb@4  @h a9@7?Pb@3 %dd%dh%dm%ds%lu㿘! Q@Ē!㿘@㿘 D@i`D㿘 D@c`D㿘`@ @ ` 4   ? $`$  ?㿘`@ @ ` 4?    $`$ ? 㿘`@ @ ` 4   ? `  ?㿘`@ @ ` 4?    ` ? 㿘`@ @ (`( 4   ? ,`,  ?|㿘`@ @ (`( 4?    ,`, ? i㿘`@ @00@4 2  @44@( @ `@00@4? 44@?>㿘`@ @00@4?2  @44@( @?`@00@4  44@ COLUMNS1ACFLRSTWacdfgiklmnopqrstux㿀'H@z  !'R@념! @gs"a`h @쌔 `s"! "!"9 "aи -@3G   "a'#)71/3;+s'~% GyS* D@€ '!%!$a %%!'!$j$a $a&%!'!$b% %!$%\'!А $%!'!$aU% &$a'!O% &!K% %G&! C"a ?@  =&aĠ  8" "3&aĐ /"aܐ +"Ȑ$ 'a&' ""aؐ " " "a %a "  " %a "a@RH@?~?#H*a'H`& aȀ a aᤀ  aa aa " a    aᤀ " a 2 a  a@aaԀ &!: 'aa $a R  !>  !: Q4h2l䀢 Q,b! Q&tQ#䀢 Q  !  ! QaP䀢 Q H! QcQ$!Ѐ VḀ Xa Va"! Y|"aW"ကH@fs!@_ @a JH L L L L L L L L L L L L L L L K0 L J\ L L K L L L L L K L L L L L K K K L L L L L L L L L L L L K, L J K@ L KT L L Kd L Kt Jx J J K K K K K K J L L J %s: %s: %s: directory causes a cycle%s: %sfts_read㿘!܀` U#@   @0 @Q@r !`d!Ħ` `  @L5  ":T  "N`D0B6 "5`0= . !V`6 !`3! T`@ h  T`@ p $!@@0Ā  @ 0 x@1`D0 `!T@3 `D@0 "a@ᩐ 2`8 T`@0 %u-%lu%qu'H'D`H !Ȁ` 'h!` !`H 'hH''' ''|'x't'p  'l8 D@DT@0 $ "!耢 2 LD2(!`2($ .2 (!`2( $  8'h  @`8`< (``<` 8'`  8'`08 `0`4`0!` v'!`T"`   @ϐT"` @Ȕ  ` @!ϒ `@! @^p4'p@Wt 4'ta؀  @Y`DM T"@Cx@ 4'x    @ِ    @/  @|$   @|$ `<  ؘ '|؀ `  $ @|M`-"$@Ԑ$l 'l2-8l`L'h'H 0'|#T''̢b @H@'t x''@<@ݐ' @4@Ր'T @*@ːp?!@!  "aH@㿘`8"2 @ 8`+ `  ` #   ? < R`6 !`2 `  ?! €㿘@ 㿘  "  @ `` ?"``* "`@\Ґ   2 total %lu %*u %*qd %s %*u %-*s %-*s %-*s %3d, %3d %*s%*qd xR 6`"!`!` a!V !@@ +V)<7V9V3V5V-V/V "!Ȁ`@ @ `!`Ԙ ; `8 @ 8@GC @ Đa`@ !` #\ $ , @ #`a؀ a @  `  "`2  `? 2 `@     (`0"@ @  (a@ `0!䀢`@<`0 !`@5`(0@2` @vDa  !` `  2`@``(  @*`` ?"``* "`@[ 2h 㿘!Ȁ`   !`  !`2!`ss!`*  @e&@@a֐ 㿐͒ #s aԀ@!!@*` @-ސ 0| &$a  ᐑ.`"@`2 @+@  2R 6`!`!` a!V!@Ɛ@ ʐ B7)   !` `?`$``@ !`* %!`@[Q ᐓ,  @ِ!`` ?"`!`* %!`@[0 Ĥ㿘!Ȱ `@V`!@ w!`!V?`8  ;` ; @@! @ `@]Da !` <`  @`㿘'D@vD#a`  L?`&  @  a`* $a` @ZҒ  $ !` !` L?`&  @  a`* $a` @Z  $ Ua`D;!@ِ !`  L?`&  @  a`* $a` @Z  $ 0a`a``?"``a` * $a`@Zv !`  L?`&  @  a`* $a` @Z_  $ a``?"``a` * $a`@ZI total %llu 㿐R mR 6`!`!`a!X #@y  @ z  >' 6􀥀`` ? "``* $`@Z   ٬􀥀  !` `?`$``@ `* $`@Y 2 ``?"`` * $`@Yѐ 㿘!Ȁ`   !`  !`2 `M%` E >`` ,?"```* $`@Y , `(sa `` ?"``* $`@Y  ` ?"```* $`@Yu   H ``2` ``?"`` * $`@Y] 㿘<(@- @@ I0L0@-8@8 I0D``?"``M /`F /``?"``@ |`9 |``?"``3 @`, @``?"``% =` =``?"`` %` %``?"`` *` ** "`@X  %s%s/%s ls: %s: %s -> 㷘V 6 2  Z D @$  Z D(@$@,#Z b!#Z!@~Oa0@b0, @ !@@㿘N *%#\J `*a  ?*: !``?"`` !`* #!`@X  N  usage: %s [-1ACFLRSTWacdfiklmnopqrstux] [file ...] 㿘P <Zb@!@  㿘@ $OpenBSD: sysctl.c,v 1.79 2002/02/16 21:27:38 millert Exp $vfsddbusermachdephwdebugnetfsvmkerncryptodevallowsoftusercryptosysvipc_infostackgap_randompoolmsgbufnprocsfscaleccputtynselcollforkstatnchstatscp_timemallocmsgbufsizearandomsysvshmsysvsemsysvmsgfsyncnosuidcoredumprandomusermountsominconnsomaxconnosversiontimexntptimerawpartitionmaxpartitionsdomainnameboottimesaved_idsjob_controlngroupsposix1versionprofilingfileprocvnodeclockratehostidhostnamesecurelevelargmaxmaxfilesmaxprocmaxvnodesversionosrevisionosreleaseostypeuspacemaxslpvnodeminvtextminanonminnkmempagesswapencryptuvmexppsstringsloadavgvmmeterposixkeysipencapnatmisdnpipinet6ipxrtipcntcoipxtplink_layerrouteappletalkhylinklatdec_dlidecnetibm_snaccittdatakitemcaisoxerox_nschaospupimplinkinetunixdiskcountdiskstatsdisknamespagesizeusermemphysmembyteorderncpumodelmachinetzname_maxstream_maxposix2_upeposix2_sw_devposix2_localedefposix2_fort_runposix2_fort_devposix2_char_termposix2_c_devposix2_c_bindposix2_versionre_dup_maxline_maxexpr_nest_maxcoll_weights_maxbc_string_maxbc_scale_maxbc_dim_maxbc_base_maxcs_pathkmemstatkmemnamesbucketbucketskthread_pagesrfork_pagesvfork_pagesfork_pageskthreadsrforksvforksforks2passespass2long_namesmissesfalse_hitsbad_hitsnegative_hitsgood_hitstk_cancctk_rawcctk_nouttk_ninvsyncblankled_blinkconsolepanictab_stop_widthmax_linemax_widthradixAanw㿘@ !\# n A0 w 0 "b  "b "b "b@ @#h?߀ ac* @ "`"` @H @u s Pbt @@ `0 2 @@ @@ `@ 2@ %s: name too long㻘@ 0@K$#] @(` ., @  $"+])@,`` @/ `@@'"@~``@&@must specify -w to set variablestop%s: class is not implementedsecond%s: kernel is not compiled for profiling%s = %s offrunninguse dmesg to view %suse pstat to view %s informationuse ps to view %s informationuse xntpdc to view %s informationuse vmstat to view %s information%s = %.2f %.2f %.2f can't find ps strings%p use vmstat or systat to view %s informationuse netstat to view %s informationuse nfsstat to view %s informationnfsillegal top level value: %dname %s in %s is unknown%s: illegal value: %s%s: value %s out of range%lld%s: value is not available%s: specification is incomplete%s: type is unknown to this program%s(calls = %llu total_allocated = %llu total_free = %lld elements = %lld high watermark = %lld could_free = %lld) (inuse = %ld, calls = %ld, memuse = %ldK, limblocks = %d, mapblocks = %d, maxused = %ldK, limit = %ldK, spare = %ld, sizes = (%d,%dnone)) tick = %d, tickadj = %d, hz = %d, profhz = %d, stathz = %d %s = %s%ld 0x%x %u %s: %u -> %llu %llu %llu %llu %llu %llu %llu %llu %llu %llu %llu %llu %llu %llu %llu %llu %llu %s%s: = %s%hd, -> %ld%s%d %s: %d -> %s: %s -> %lld %s: %lld -> %qd %s: unknown structure returned%s: unknown type returned㺨Ȓ''$@'@ =   '#]*!u"` =]a@T @**c\'   ` ' @ `  @ߓ'' a@ ?C '@ u@+u ,   s"t]@&T!0+ ]sbt@ 0!b@ p?,  'Ȣ   ['c"X* €̒?`%Uc!*` € ''АȒ  @` ?`"`]]"@]@Z"0"`]`"@]"P]"XQ @P0ΒȖ@. '@0Ȗ@ Ѐ "$ 2'`]"``]"x`]"`]"   ߬"(ܴ ̀ `]|"̀   @b ]#@]#@#\0e)  'Ȓ  @Ś ?`U"`]]"@k]@ÿ#(0I"`]]#@_]@[#@0< ?Ȗ@*= `.]%#H̀ ) Ȓ@  Ѐ``Ԁ `fԀ c` ] "#\@XR Ȗ@ `E` `Ȗ@ ]ސ#x '1 Ȗ@`(0̀  Ȗ@dȖ@ ` `]]#@$ߒc0]#@$ڒ 0`]#@$Ҕ0 7  )$2' ""@a '@_P 'J`^  " "^ (@$0|  '^`H@ ''$'Ȕ@Җ?#`b " "^  ^  -2 ^^I P^F pD @H @$<0C5"`^]#@W^@T ^  @N ^  @H ^  @B ^  @<!^  @6! ^!8 @0 ^@-!P0F"` ]#@ ^Ȟ!Xc̖gؗ: Ԑc֐gܑ: #\:` #`#d@c )^%^ `!@ @ , `^@!^@!0ƀ"`^]#@ڒ^̐!@0"` ^!^'|"8@md|@"@0 "`!]"@  "` !]"@ @i@0^"H@ 0~  "`2^]#@^"`^Ȑ"X@^@}"P0^["`2]#@q^;`0"h;8;@;;h;p ;x;;; ;(;;#\̤ )^@JԬHH,@@" @@ , ," @4 , ," @( ,^@!"0 fb  ^`"^"^"ؐ @  "- )^%^#^, 2~2 * Ȓ `@.  +  "b@2 *`2 #  )b ^"@Q` " 1^)^%^, 2~2 *  `@.@  +  ""@Ǖ2 *`2 # ``?("`0,-"`]#@-^#%^#^ b@2``?"`` * q%`@P2 0m?`ec!*` €  "`2^]#@u^"`^Ȑ#@i^@d#0E  "`]#@X@07"`^# @M@0, "`]#@>^#0@90"`^#8@0^@#H @) 0 ^#P@".0^#p@")  h P  (  } X < ` h ~ p ~ ~T ~p  }  (  | Tkernel does contain bad dynamic port tables, cannot mix +/- with full listinvalid port, range is %d to %d㿐@< + !@6 - ]! @'" @ ?`\ c]"@c@"0s ;c%c-5c + -@` @V`~* 2 ! +ؐ "@R# *`2 >2* ,@@ $ 2 >2`*` ,@*$  ;b@! 7bJ@  @1b" @? @@Uʐ * 2 !*cbؐ "@#22*b  * @#   cb@! bJ@ b& @'㿀u  (`(@b# (  "' ' $ %''  @Y ?$$&c@confmaxtypenumsd_dir_entrysd_direct_blk_ptrssd_inode_bitmapsd_indir_blk_ptrssd_sync_limit_hitsd_ino_limit_hitsd_blk_limit_hitsd_ino_limit_pushsd_blk_limit_pushsd_worklist_pushsd_tickdelaymax_softdepsdoasyncfreedoreallocblksdoclusterwritedoclusterreadiothreadsnfsstatsvfsinitffsmountsXu  P`   ''''  @Ӛ !`*`@J' $" @W*!@>*  $"@_0 @H*!@/*  $"@P@N0n @7*  ( c@' N'u ua" 5d3d1]?'  @І   "`-/@ @ b0@@bc  ""`@W#Ȁ  ""`ԑ- ☠"@@s+b "@@"`@0  bd"c@# ""#u?`# "P"Tthirdvfs print%s has %d mounted instance%s sh "0>"ebx@6 &&  ('̐& Ж̘ @    "`-"e@"0耢"`e!`be"^" @0^!`c@ ?No variables defined for file system %s㿘"* @  @$e#@ ? e" ?@bx?b* + &&@   '?setuid㿘 eua<?!ubx@x!<  &!<*`  '?keysdeletedkeyscreatedenable㿘 euӒa\?!ubx@N!\  &!\*`  '?ipcompetheripmobileipahespgreudpegptcpipipggpigmpicmpipipsec-comp-algmtudisctimeoutmtudiscipsec-auth-algipsec-enc-algipsec-firstuseipsec-soft-firstuseipsec-soft-timeoutipsec-timeoutipsec-bytesipsec-soft-bytesipsec-allocsipsec-soft-allocsipsec-pfsipsec-invalid-lifeipsec-expire-acquireencdebugmaxqueueporthilastporthifirstportlastportfirstdirected-broadcastsourceroutettlredirectforwardingredirtimeoutrediraccepterrppslimitbmcastechomaskreplallowackonpushrstppslimitmssdfltsackidentsendspacerecvspacebaddynamicslowhzkeepintvlkeepidlekeepinittimerfc1323checksumwccpfourth level name in %s is invalid㿐@  e @R"@w͒b|0Vwbx|@H?M&@ g@!`0C3wb  '@  @D 2 &b"`?]#@?`$g#*` €"@"D "H "L"P"T"X^@ʐ"@0"\^@Đ"@? 㿘 ewcb?wbx@ޖ℀? & '?㿐@  e @R"`wEbt0Uwbxt@?L@ g@!`0C3wb  '`  @ͽ 2 &b"`?]#@c?`$h!4*` €"`"d "h "l"p"t"x^@C#0"|^@=#? .fourth level name %s in %s is invalid㻈@ ewВbl?wbxl@J? K&h@XaX ?$' &'  @H &Ű?& @  J ,"`  *J`@U  '' 5^  "  @ / "@  W@Q9&     ' $' &'  @ h&@aX @ @  J ,"`  *J`@  v'' 5^  J` ? "` @ʐ/ "@   "   "@]?05@iP h!`@j+?@ՅL`, @L` 耤L? ,  @   J ,"` @*J&  ?' %s: no variables defined for this protocolfourth㿘@ evΒb9?vbx@H.`l &v#*`  @  i@!X?@ i?a@#  & *`  '?pim6icmp6ipsec6ip6udp6tcp6rr_pruneuse_deprecatedkame_versiondefmcasthlimauto_flowlabeldad_counthdrnestlimitlog_intervalkeepfaithaccept_rtadvsourcecheck_logintsourcecheckmaxfragpacketsmrtprotoforwsrcrtmtuhlimnd6_debugmtudisc_lowatmtudisc_hiwatnd6_maxnudhintnodeinfond6_useloopbacknd6_mmaxtriesnd6_umaxtriesnd6_delaynd6_prune㿘@ exc<9?xbx<@.`g &x#D*`  @  i@O!X?@ i?a@j  & *`  '?spxnetbios㿘@ ey̒b9?ybx@F.` &y"*`  @  i@!X?@ i?a@!  & *`  '?%s: incomplete specification%s level name %s in %s is invalid㿘  h@aX  j"@ǒ? . @`" @ 2 j"Ȓ@?usage: %s %s %s %s sysctl [-n] variable ...sysctl [-n] -w variable=value ...sysctl [-n] -asysctl [-n] -A㿘jjjkkcؘ `@ʐ!@ѿ 㿘@sumo:12illegal argument to -o option%sstdin㿐@'Dk`@ P`<k@` lmm!am#``! 7k1k-m+m)k#k9k ;k o"@b "mm!a@X H aP@! @QD@MD@`?݀ ?c * @  @  `@A  @ϒ    `@ 0Ā@@ @(cksumusage: cksum [-o 1 | 2] [file ...] usage: %s [file ...] 㿘!Pk <@b k!@b0k <!@ b@  ;n C&vkkMGP&"/+Ka5 d1͆< 8OLpHEAR_[԰VRVuj6n+c gZy@}]p{zt^f͘#W`9'<݋Rd+[XF﷩`6h}/-03l ]2mp'ݰVqKI6Lδ "u=:(Fy>C͚}-4pw0Gm=K9V'#C.=* rOx ͻK} x|VqiuԍkoRlbf^FZ^[W}S`fM0cIZ-D @Ɨd 'NK`#%▒+/l6/A ]h@D+f{*uP6&;>k;qv2PUMƼ_}>1ֆոy4:Zi mY`ۀdO7z2~ɋs\wKO VKF68BG+\{Xf=U@QC]S%;!&),(^G6MB2P?v,;Zk&ˑ HVнMR#/VKm`lp+ =eh 'ޥdo#j͡`볽>~ɴ}:̣y{6`Ɵ}q[uF2 -tq0]YK.TPɶ@NEJOG +C{}!C`rFOv[h lGJa0e-$KZV^pm0=5^ [7Q3R>?:Ѐ$Ѝ V:-)Tũ&yh;+֭PlM/kv|`v#d'sĉ yྀ:gК՞}b> q 2+ߢ6hfmu{ڵ6]@?cz` 8"`  !zk #`4`0 @ * *` ,`(  $ ?@NJ 4ߤ  &zk#` 4`@3`*` * ,`+`4  8&@  8% %lu %lu %s 㿘m @S "mm @Lm@I 㿘m @@2 "mm @9m@6 㿘m @-2 "mm @&m@# ?c  ?#@`2@ 4`  ?@ 4  &@& ?c    @@`?@ 4  ?# @4`@ @4` &@&  㿘@tsetJ0 J@, @Hc\  * PJ ( P"J@"2  J` J@ @ c\ H(P* 8 @c\@ *`HP"(8"tset: 㿘!!nH'H'L'P'T'X`@@an@`@Ν 㿘na@En @rɐ@Γ write to stderr㻘 @   @??2nߐ!@-$ Ԑ@㿘!`? "`` *:  ! * #!@D Terminal type? [%s] Terminal type? 㿘! @n@B`@7 %'+n)n-n`b @5@0"8@H!@M?P 2 `2@@ @t9 2*LH `"b  2 K n x p h, `X X P H ` @ 8% 0K ( 0K ( 0K (  23040011520057600384001920096004800240018001200600300200150134.513411075500unknown baud rate %s㿘N B  n#D` ` 2  `2 o ڒ malloc><@=!:illegal -m option format: %s㿘@v@  oҐ!8` $"`" `""`o$ a@@P$  $ K$ @2$  @?ߑ* : `o#h*` € : $  4 $     $ `*:  : "o `@sE : .@u`$ ` $ , 8 $    "$ o!HN$  \ t 㿘 G  " @~ 2; `1p!*` €+ R`* @$`?R * @  R * @  R * @    R * @    `"  2  H P l TERMunknownTERMCAPTERMCAP=tset: unknown terminal type %s tset: can't initialize terminal type %s (error %d) 㿐 2pp@e!8 @  " p@N@ "p !@tp@M!H ,J /")N% @ "#N)p b!P@  b`" ⠠  ` "N @ bN ? !N    !%p#p!@`0!@a  @Jd 㿘 H @  "  `,    ,   `,    ,   `,    ,   `,    ,   `,    ,   ,  ? ?  c @ # k!, $$ $ $  @ƒ 㿘1 8J `"  ܀ "  @d 2  8 `J㿘 H `zȀ & `HȀ ,  `, `H  z`̀ & `H`̀ `  `*`H  z`Ѐ  `Ѐ `  `*HH ! H`8" " H  `8H`8 >"# H`8H*  H  H  㿘@Iz `Ā$! 8 a耢 n@鱒   8 a쀢 n@駒   8 a `̀ " f   a`?"``! * $!@A2 @ !@*# 㿘 8`b I ` E a`?"``! * $!@A  8n  `@Q `  #r!@Aw`8  @@! !!`?"``! * $!@@ڐ  %s %s isset todelete. backspace. control-%c (^%c). %c. 㿘`t` @ H  @: r!`ar!hr!p @T `r@Max0" 8`܀`` @@ `J` `r@:a0 r`@a@1 0ra@+-q-e^H-i^C-k^U㿘 >'r%r#r!rJ@ -  J 2J@( -2)   "J`J -2! J` e i k2 J` 2 J i" b k e  " @sT&  2usage: %s [-IQVrs] [-] [-e ch] [-i ch] [-k ch] [-m mapping] [terminal] 㿘s`!@Ô@ɸ  H^ bH?  bHstandard errorreseta:d:e:Ii:k:m:np:qQSrsVarpanetdialupplugboard%s Terminal type is %s. EraseKillInterrupt%s No termcap entry for %s, only terminfo.SHELLcshset noglob histchars=; setenv TERM %s; setenv TERMCAP set noglob histchars=; setenv TERM %s; unset noglob histchars; TERM=%s; TERMCAP=export TERMCAP TERM; TERM=%s; export TERMCAP; '; 㻐 H@F @= `Hs `H  t" t "` "` "`  "` "` "` "` $"`  ("`("`$@]2`*@K@s@z` z  *`      L!s`4Gt#*` €B  "so!< "sh!5)* : z-"`+  * : z$"`* : z"` "K  "sD!      @۰ @L@@` 耢??#*`& @ @5@@ &/ <%81 !R@& R` $ `h@ʙ `       `77`g@ʂ "`J t`H@\ ,  @ 8@Nt@ s! @s!a(@Ms!@ Ք s!H Д s!P ˔ O  s!`@ڒ@fs!hoAs@! "s@s?@ya  sO s!s!s"s" b8@O`!!``?"``!` '* $!`@>? '@%s"x@>!`@>!`  И И И И И И И И И И И И И И И И И h И p И И Ј И И И И И И И И И И Ϡ И И ϼ И И И И  И 4 Р И L Ϙ x Ѐ()%'&*+#   $ "!$"#%&!     tsr2  u0kbok p r3iv4jzj`% w.-/f l43n5m+, 601279:O=SW;<@?ABCDEFGH    IJKLVMNTPcQRU>8Z[\]^_`abcd1vwxPJOIQKRMHdLg*)hstuiN!\~]ye"}qAB&()C*Xe|~+,z{|DEFG@lmnoZ-S[6hg/x.'7y8TUVpWXqY9Yf{}#$:;<=>^?_5 !"#$%&'(a%#&(*  )$ '+!"$ "% !  #&tsr0123b ku  v4jzw56789:;{!"} <#=>$?%&'()@*ABC|~D+EF,G-./f0123+,456789:;<=>?@ABCDEFGH    IJKLMNOPcQRSTUVWXYZ[\]^_`abcdefHIJKLMdgN*)hijkOlmnoPpQqrRstiuvwxyez{|}~Slmnohg/TUx-.VpyWqXYZ[\]^_` !"#$%&'(a() !"#$%    '&*+  $"#%&  !hgn ijk    fl+,copqdpez{|}~mq/.rrytuvwx0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abs&5 k  j%)*./ 024361ABDEFGHIJKCN9;?TPM<>QRU@V87=XLOSY:WZ[]^_`abcd\' fe!"g*)hwstxvuz{|~}ylmno+#-( !"#$%&'(,$- i㿘     @Q& & @? @& * 㿘`|a(& 0@[ג㿘@ @L ",  "R  0! 0R z `R#z! `S !R z!0 `S#ԓ*  SVr1SVR1UltrixHPAIXBSD, , :\ :%s: sorting by term structure order %s: sorting by terminfo name order %s: sorting by C variable order %s: sorting by termcap name order %s: width = %d, tversion = %d, outform = %d 㿘z*`"Ā 5"#|bH@qא |bP@qѐ |bX@qː | b`@q | bh@q |  @qbp  "` " `I" }# .` €c̖ # #` |a| # #` |"x|"|" "aRSS||#aԖ␘"!#` #$!"  0E- 0@>z |!@ab7 z |!@Vbuuu ap  z |!@Fbwww a4z |!@7cyyy H`"# #`쀧  z |c!`c@@  P P    0  0H ? *` P? ? *` ? P~ (" ` 0A 0>`< : `"` 1 ````(& "瀢`݀ `  z 0  0 z   z0   @ 㿘!!  " $ 㿘@S`@N  ` z#@ @ !! ̒אԐ$%?%pe%? %%%%c without %%?%%; without %%?㿘~a@Sڐ    @ 2~b@Sΐ@ N +`خ 7~*`:  e"$  p ;"j  ? % 9 \  9 t   `a    9`~b *?@rc   -~  #~ ؒbD ? ؒ= 9 n  -~%~` ؒ- ? ؒ& " N ?~`P`2NNN@Mϐ INA9` `؀  *? -~3~ ؒb ? ؒ  0+~@M"8 9``-~  *?#~` ؒbڔ ? ؒ Ӕ  9 ذ ˔ N F@%s@%s#%dim=ei=%s=!!! %s WILL NOT CONVERT !!!..%s=%s=%s=meml=%smemu=%slqkxjmwuvtnbox1=x?#?'Tc*@  "@` }"!c ! ̐    " ? ܶ"P5?#7 +  ` -  +  " " $ * @ ,    (  X`  L O L T"  @@RZ @X04X    +ༀ " =  V?#+% &  ` -  &  $  "" $  * @ ,    *  X`  L O L T"  @?,  R@@R2a0@R. 4    &` -@= 2  2  &,`"  Ȁ "  @n9 2  "  a쀢 "  @n-f, 2  "!  ?# ؀!  ` -  !  & "" $$@   *  ,   2    X` L OL T"  )   Ѐ`ᰀ   ,  |@    !Ȓ਀@    !Ф ^' @?/  ,    ?  ?c@"@ a@Qh7   ^"V4 {,  RT @ק@y <  ?aؖ@QC6  c a@Q5@X @*` ,!` \L : \, ,2 @ @ ,` @ *` ,`  b@Q   @-@֐,  T@P`? b Ȁ` #   ` @@ `  ? *   &l ?#b@P  &pD?#b@P09 ;` "H?5 3?#@   `L@`  @a H " , ,"0?"0ccc7  ' T`?@ΐ@VH `9    ̐J?`  J?  ?"  ̒ J :J J  J \ ?" ` `* "?ܖ@W`́older termcapterminfo# (untranslatable capabilities removed to fit entry within %d bytes) # (sgr removed to fit entry within %d bytes) # (acsc removed to fit entry within %d bytes) # (terminfo-only capabilities suppressed to fit entry within %d bytes) warning: %s entry is %d bytes long # WARNING: this entry, %d bytes long, may core-dump %s libraries! 㿘 ` !p# @y !#   V` S@੐! Fb !bH"b @ "bH"@ #3` &`@y"8{ #!a@?ؠ"@"@`&`"" "bH`@0|a`%s%suse=tc=   ?#```  @O< ?#  @0Va` ` comparing booleans. comparing numbers. comparing strings. use㿘2`!p@03a`` 5 +  ` ,  + `"`" #`* @ +   ` X`  J OJ T"`  ` р +2`!@/a`` 7 &  ` ,  & `$``"" # `* @ +   ` X`  J OJ T"`  ` π &2` !@/a``  9!  ` ,  !`&` `$" `"#@  `*  +   ` X`  J OJ T"`   `  ̀!   㿘  ? " @^ *  @5 `"  2 D !? " @^ *  @5 `"  2 F f(? 2  `Ȁ? " "f( "  f,? 2 a쀢" a耢? 2  a? 2 "f, "! R`B?2 R`? `  ? 22`B  !  `@j `?, )  8? " @^B *  @57 `"  2 H "? @^. *  @5# ` 2 J㾘 "H?[ Y  * :     "H J` 2J *  `< !@c  H `H J@ +@   HJ `2H  ,`K@ "  "H*@   H *@  (K@  "H*@   "H*@ TERMCAPTERMPATHHOME%s/%s.termcap /usr/share/misc/termcap@x >@} L /.@t! @`"$)$@@i! "L "@8 !# a @M $@a @`$*@_$$@`O  J@  :2`*@`J@  "` :"`  $@`@ܒ`J@ 瀢 $@L  / @ԭ +?'t@t t t@_$@ : ?L 2,? t ? ?@? ?termcap names not colon terminated| %s%s:\E\040\041\054\042\047\140㿐 :@\'D 'c@ *@ 'cD)!- `@9Ӑ 2 # @N#@ 2N!``?"``!` :*#\ @ `   N  `2 oWN倢`E?#l*` €@ @ FN@  (AN@ 08!@1p"@03.2 *+ ( & # !               2`*Ԑ ے ~ݐ ?' #"L"''//aa (' ' ' ' ' ' ' ' ' $''c@M ?2$WARNING: terminal cannot %s㿐!8` z#`'"@/oLINESliCOLUMNSco㿐zc?  #@  $# $## @`h  "!@ސ#H "@/@Ȇ#P"aa # "a#`h@۔  򀢠"!@#X "@/@c#`"aa  P"akrklkukdkPkNkh@7kDhЮ '@p  1"В@H@\  ,@  ,@ @G@O  ,@  '@M "В@G@=  ,@  ,@ @GԒ@0  ,@  '@. 3"В@G@  ,@a@@G@  ,   '@ "В@G@  ,@a@@@G@` , ` '@  a@@@G@` ,@` '@  a@@@Gv@Ґ` ,@` '@В  "А@Gd@  ,@  '@Ǿ  "А@GR@  ,@ !@Ǭ'̦ "А //Ҧђ@G<@  ,  , @G/@  , aè //ђ/@G @| a ,a䀢   //@G@j , a@@@@UTERMunknowndumb:hc:hcamxndadbsgpcksketitececlear to end of linecdclear to end of screenclclear screen cmsoseusuemdmembvbbsbchohome cursor|^llmove cursor to lower left of screen alsrscroll backwards㷐@!P !X@Ÿ 4 ` `/?@Ƈ!p@.B@ƀ!x"a@{!"a@v!"a @p!"aT @ƒ! "`"``#!"a#a"` "  d"!<` '@ơ!`" ` @* (@ƕ! "`!"`@Ɗ! "`!"`!!`#z#`2  @t!$ !@o$` `!$ ` 2!$`@\!В " x`J@ 2 V!!$ x@E!!T`" | J 2 <!!$ x@+" " t`J@ 2 %""($ t@"0 " p`J@ !% p"ah "ah@"8" `2!$`@"@" `2!$ @ې"H"` 2`"`@ΐ"P"`  "`"X@" ` " "@ű"` "`!"`"h@Ŧ" 2` " "@Ŗ"` "`!"`@ŋ"p"` 2!"`@'"x "@t" "`J ""`"@e` p! pJ@ !  @  @D@C @'@r"`d"@:` p! pJ@ !! @ߒ @D@ @'@E"`l"@ `!"@ a!aȀ  " h@"`h  hJ`"!tค ฝ㿘!!`@͘$  㿘N  N@ 2Nϐ "N@  ݐ6㿘!``#!#a@j`@eaz "c㿘!`%z `#!#a@O`@Ja$㿘`d@@ 㿘`h@6㿘`l@- 㿘`p@ @! 㿘!x`@@*] 㿘 J`! @㿘`t@㿘`x@ 㿘!T``|@ 0`x@ߒ 㿘`@֒ 㿘`@͒ 㿘`@Ē 㿘`@̻ 㿘`@̲ 㿘`@̩ 㿘`@̠ 㿘`@̗ 㿘#!#` @̍@)Ӑ `@̇ 㿘`@~ Nothing in top lineNothing in bottom lineNo bracket in top lineNo bracket in bottom lineNo matching bracket㿘 ?@*?@  "!  !@v ? P0񀦠@  " 8@) 0#T   @A ?@H$?쀢 p@)ǒ seek errorread errorWaiting for data㿘  `$  2 `( @+` 2 `  ?`a(    ! `@ 2$!(` $ & & `  $ *` @ @Ҧ ? 4`2?@(?``2``{` 2` y ?@ ? `2 : !@)I g?: { ?   $` # @'   `  ?*#  ?怤  z!@)% j z#䀢   `@p ` <  B;  & !` ; 0 "@)C @  !`2?`` "` "& &" "`  ( j`  ch_ungetchar overrun㿘? !{ ?!@(͒ $ Finishing logfile㿘zc䀢 $ { #z `0?`4? "!@( !@?! @?$$cWarning: log file is incomplete㿘 `cB  gB 3` +    )'z``@2 ` "@(q    2@` @``"  2  2 㿘@ U? 4Y @ 8T  cF  3` + @ 1 @*`Ð %```42 `8,  `@?!```2 `@ `  $+   cF + 3` @* @ ( 㿘1 ` @`  :0@;? 1  2 @B?! 㿘 w   2  `@&  2` "`("`$?0?$(( 8㿘 $@ (  ?  ?`(#4`$ "`("`( "`$㿘 `( ?"`(`$$#?`     ?# $" (" $ $@ ( @ Cannot allocate %d buffers㿐!#  @6 @I   `` & @''  `2    seek error to 0㿘`  ??#:0  ?"  2"  @`   :0  :"$"(  @ ? @& 㿘 @|$  ?   " """"@" 㿘 @   # @" @  `" 㿘  @ۖ ?  㿘#z@(c  "` 8@|M ?  ??" : " : 0$ " "" " " $" (Ր  ` "`c@  ` ?""` d㿘 `  ` `` 2   2`@` `?"`  @`zc$`@ڒ 8bcccbcc18b95.bb125.bbnext8bcccbcc18b95.b128.koi8-r8bcccbcc12bc5b95.b.dos8bcccbcc18b95.33b.latin18bcccbcc18b95.basciiinvalid chardefchardef longer than 256㿘N Ѐ` : +*:  9   06,  . `0 b c`0     * N?? @% R !%@*,@@%ߒ G ,@? ` N !Ѐ@,@`@*,@invalid charset name㿘 "  N {  0 `  @[/ "   2!@%  㿘b@3 #\  `Д  J ` * "* *  *s<%X> J*J*"{J k{sd { < u{ <  <  <{  <{  < { 8LESSBINFMTLESSCHARSETLESSCHARDEF㿘@֐#@ѐ#v @ʐ#  J@  0    %cESC^%c㿘   !` !`@>J  { @ܐ  {!`@>:   8!@>3 Ȱ ȁ""L("bH"P㿘@G!Ё㿘 bL!Ѐ@J !$LJ"H@1"HL"@$"H. N 2 H@jH@LN *: @$<@ N@`H@{LH@{ `  L!Ѐ@M!Ѐ   㿘1"LJ " f"L`@$ &"L@ߐH @"H㿘"L aЀ ("LJ? "L "LJ? 0Ѐ J?   o"LJ?  㿘bLJ  "LJ@ 0 "LJ@   㿘%L!Ѐ@!bL$bLJ@|"H"@$"HN  LbL 㿘J!Ѐ`  bL4*{ `?㿘1"LJ " "L`@#x&"L@JH @"H㿘L!Ѐ@"LJ!@5"H"@$"HyN   { 㿘{ `̰ 08   ` @"   ` "0!"bLN %bL *bLuJ@@H@$H@#bL $bLN`L *㿘{` * @ؐ!Ѐ #``  @XܒЀ 2``  `$ $`$ `""``"`㿘{ { @?`D  `@ Đ`"Г*` €{@" @{R" @{"L"`@J``  "L,"LJ@  "LJ` { "LJ@  0rL a{" @  K? "L "LaJ? "LaЀ U J? %  "L(K J? E {" @@{L" @J@  "LJ@  0/{" @, {" @'{" @"{G" @{*" @{l" @ "bP{" @  @ {" @  Z Z4 XX Xl Y X Z Z\ Y Y ZH Zp Z Z Z Z Z Z Z㿘!@ uK!"H_@ݤ"H  $"H@ѐH "@|$H0G@ɐL  , L? : L* $LLJ?`%?0L@a@@ @H$@@ H@VG 0@! L H@ ӢH@ 㿘 *`:   (L   㿘bLJ   ! "L"LJ@  !@ "LaЀ  J " "L!Ѐ@  N?   ? N? 2?㿘%T @$T 'X`""\@ !"L " "L"@$S$X"L @@ *@"L$T*@?㿘   1 "@"d@"d㿘{ @` !"T`2  ""`"d@N$`@ Ґ"b` "`ː$"`%L b\  "L"\@` bX$`@9 $`@d 㿘bP "bP@<      㿘@!Ր!Ё㿘@ @H@"H!㿘@ u㿘O""GԀ @ @*!/?㿘b؀    ("b"؀!!@"؀ !H"؀ @!P"؀ !X{!`{`T!done|done㿘bԒ`*e#*` €"@:0YL@!zL@ +"` "`#Ѐ "L@@L@ D$#@$#"!L"@q8,""ܔ L`WL@00"ܔ L@PL`0)@0&L@ ! !{ @@ =$  @t" @p"(@ K 0 Jb@ݒ"0@ B  b| c c c cP b c c c c b| c c c c c c c c c c c c\ c c c c c c c c c4 c c c c c c c c c c b㿐"Ԁ`/#*` €?Ѐ v@  dr "b$ ! d!L `J"  + -X + -! " "b "b䀢 ,b@  Lb"@b P Lb + -1,b@  -/// / 8   *  @ !0 0 @! bذ  "b0  M   ?݀    ̰  e f f f f f8 d f f f f f f f f f8 f f f f f f e f f f f f f f f f f f f f f f f f f f f f f f f e[Press 'h' for instructions.] [Press space to continue, 'q' to quit.]㿘{ `"p@Z@ _    ?    @   @  ؀`!!| @/$!|$!|!` ! ` z@ )cԀ a E!!  T@#X$!@#' @i :0C@{!`@t#Aless version %s㿐}`'!@Ò㿘{`"p@"J" @ "Ԁ   g   0 @(ungetcc overflow㿘!{  "p$  "Ԁ@ "@   * $ 㿘@? Lݠ?:LPattern not found㿘 bz#Ԁa `@ @ 0bؠ  >$b%@Ɛ  @ؐ  ` ؔ@%  b؀ 逊 `#X@*  @ 튐 :%s helpExamine: -Cannot edit standard inputCannot edit file processed with LESSOPEN(N-th) No %snext fileNo %sprevious fileNo such file_+mark: goto mark: |mark: Brackets: 㿈a 2  :    ""@+%3)1Z%b!$܀  .b@&!`#?! ! bԀ "/  bԀ "/[  '/'@D쀢 ` ``c/#*` €` l !܀`"!l܀ @Q$Uܒ @ ] 0܀`"!l܀ @>$Bܒ @  0}܀  $6=܀  $-?܀  $$+ ܀  $, @ !  " "a   @  !  A$!܀ 4%@@ @  05܀ 4%@@ @ K 0* @@ p܀  $@ ՞H܀ &$܀ d d$@ 0܀ @ ܀ &$ :@ 1\0@ 'Ő  ܒ  $$ܐ `$ؐ $ ܐ $؀` $& 0؀ ؐ ?  ? " ؀ ؐ ?  ? "@ܐ $؀` $[ $@!:L!`x0@ F@  0{ h`D 0!z@ #@Q` 2{[ "4`T 'a,@  @J@#Ԁ ]댐 0Y܀  $@܀ P!`! `w ܀ $!" '!܀  $@܀ 0܀ !" '!@0"܀  $@܀ !0@ݒ 0` /֔  $"ba@ ͐  a !L b @ 0aH  0{ |aP 0aP  a !L ؀ ր @0aX  a !L   @0ah z %a !L    .@m { |*aP] %0apW 0bԀ  aN m0!  |"a p o q rp o0 u w s v q0 o o` p rP q qd v s tt q w t rH qT v8 v r p, pT r8 s oL o w w v uP s w w w r r r s u w w p| q w w w w w w w w w w w w w w w w w w w w w w w w w w w w w w w w w w w w w w w w w w w w w w w w w m㿘{ @)!L{!@= C@O㿘  @p  @&""" ?Warning: some commands disabled㿘{"$ߔ "@ Warning: some edit commands disabled㿘{"(ǔ "h@ @ 4J@K)`J@ g`"#!" ?J`g2J@ fJ@`J@`J@2``@ И  d㿘 d     d"㿘{b$㿘{b(H"H("@㿘@J J ?l 㿐@N E26?N n22?N d2.? ' J `e'`x`c0 0ĐC S'@"?  㿘@zi H @~  @o    @ ?  @@)?@@ݐ< "N@? N  M N  +N  Glz .lessCannot use lesskey file "%s"㿐@:"   "'@t@x! I !L C `` ܲ` `$--,   ` 6 d` "  d   d  d ܀  M`0 㿘z@&@@  & N@ ".@ `@*N@㿘`@s@ @   N@ "`@  `2 @ J"?8J?   ?J?8?㿈zcԀ " @耢?쀢?@;@L#{b4 " $@)b@@b4$b4$ԁ㿘 z#@ 0 @-%s"%s" may be a binary file. See it anyway? 㿈z#Ԁ cԀ  " @'@   S b@M {"0 H'@Ӑ '"@U@쀤`@@@cr @xҒ  '@'"@8@s䀤`!p`@ @w "'@w쀢 y Y@FȀ`z"#{""4"b@%cc@` "0fz#쀢`#a z@ z#Ѐ !zy#܀@\`?a `$#@@ @  !`'"@֒ 㿈#zcԒ  @Ő    @+#Ԧ @ # @ #Ԁ     㿘z"#@  㿘z"#@ 㿘z#Ԁ`  @? ` 㿘z#Ԁ`  @?Ґ ` 㿘 @~ "  @Missing filename ("less -\?" for help)㿘{@b0 " #@/ 旐 "㿘0@?@Warning: "%s" exists; Overwrite, Append or Don't log? Overwrite, Append, or Don't log? (Type "O", "A", "D" or "q") Cannot write to "%s"㿐 H@w~ @ z#耢` O '@5!? 0$* "X@€!@玐z"c @w\ !z$#  @ ?#䀢 @#? $#"  @  א?#䀢 '!@   P                              P            %s/%s㿘 % L@ !@ݐ@ڐ @l   c @/@v @ @yHOME㿘@ߐ#В  LESSHELP/home/dest-sparc/usr/share/misc/more.help㿘@Đ   `㿘L@ # @'z%z*`:  # %2 Ԁ 0 ؀ C4@x`@r`L@  @ E L@  @1z'z*`:  # %2,#@W`@.@N `L@  @,%s*㿘@=  @/a@@K@ @ @X !  @ݖ ?2    @ @  u @   㿘  @ ??? 㿘 dŒ  d@ ,,乐@.{@@Ԑ, ? $@aA  $` ݒ$,SHELL%s -c "%s"r㿘@`@" @  @.x@#ذ N c@@ g c@._@Lc@@Decho %s㿘  |@N`@(0@%LESSOPEN-㿐?@t!h " !x@JT ". L |    `T @   @ߐ O&&@ 2@АN@` LESSCLOSE㿘"@@/"x P@8@u. @)'!p`# < @   @ 㿐 @-{b8@ @א 㱐 @-s{bH@38@֒ Đ 㿘!x`cm㿘!`!`@??  @ a  "a 㿘a @<"a...skipping... 㿘    a?4 !  a?   F){!|`a?Aa|@   "` Ͷ 0){@G? @ @ '@ @\a|  '7?"` '@J '-?@C &"` 3?a| a|  {"` a|{"`a|  "aa| @x? ` ͢ @?Ǣ Ő¤ @ߐ ?ᄀ "!  !`a  "a  %"`"%"`@i%"`@ ?㿘@   a? "! @`"@? @1? `@)@ܐ?㿘!`! ` s  EW 0A@d??5 3` ! @ )!`@   @E     @=??  ra   "a  㿘@! ?  `@?@PUt  | #?Cannot find help file-%s -m -H -+E -+s '-PmHELP -- ?eEND -- Press g to see it again:Press RETURN for more., or q when done ' %sEnd of help㿘+ #@O 0@#@a ᔐ a@+c@y@[ #@4 @o{h   " 2 㿘`2@{"h@ && @" `&@& {b "b㿘 ?" "{b?"b㿘 (E 0& ??> & ʐ㿘 !z#Ԁ@#$#Ӑ@ @ {hh  {h h 㿘 2  {㿘{"h"h "   @G$ 22  㿘  "   @: `:  :@ :` "   " 㿘?%!<`{"*` : @ F @>  @@? @?Z? +# (#B? @ !`! ?  B? a ̀ ?u!  @` 0a l  ?W 㿘 `!<`{"*` :  @ @ f   @xF? q `'-0.QO  -% ZB  ?-0N `B   D, ? 9 2 @Ǩ@Ғ-/B? @   2" @Ð D@? @? ?D  @Cannot seek to end of file㿘S #@4 0I?   !  @”0!  @Cannot seek to beginning of fileCannot seek to line number %d㿐@x?  箒  !\@0(  T@\ @ 0' @ݒ㿈@,@@rDetermining length of fileDon't know length of file㿘?  !@ ?  !@ 0> @T @Rd d   2@ 8D?!\ @ 㿘9  ?  @Cannot seek to that file position㿘@А@l & @ΐ?   ?@Ɛ   g  #H@< 0}@  @??   @ @8;'+a@8 "?   0N#? ހ@a"a ""ؚ%?  0/+4 @  0a? h? 瀤@" ؐ@a?   "#"c"* %6d㿘!Ѐ`B@q1"!!pb@@'"@ b   "b"b * ?`#b!  #!!!pb1 !""&" , , @y$" """#      0   0  d      0   0  `㿘 &? ! "`  "J ` `"`"J 㿘""J p#"J !""@$"㿘`B @7 2 !X`@@@ 4J "# B %#`?pJ ` bN `Y   ?." `5bJ   `2 bT  ?&b* p*  &㿘J# ` #  @ ",    !؀`, :# @㿘#c /!"!pJ . :`@$c  _ _   ) U G  " $" $ !؀     0|8y  * r l"`k   f$ca   $a!1    N"`$""@xga  J ֐ 7!X`ɖ֐{`<{@K@@@@4' N "!*: і "  $"N`   b "b 㿘J# ` `  2 #  2 b!` !` !X` ap + *"ap*@*~ "@P@H H H "@p   㿘??  ?? ?!p, `   !o B?,ap&㿘 42 ?`㿐F? ??  !p?<,, ?8?]`B 2&@   #@& c   8#c  8"& 8  @ b ; 㿘##Oc  4 #8 8 #8  @5##8!"!"`:`"@"`$  &@ #cc  `   4 2  8` 2 #a " "@Calculating line numbers㿘#@  { "b㿘!!   d$!@ $!` ?$!㿘!Ѐ`?   2 `# ### 4 @8 x@ u@ # "a   b@ f 46 4 2Y "! 8 ?"E @{""421@.0+m 2( "!  ? T@{""ې㿘` a ##  & R @ #"     "@$@ !   25? 6 % & ? "!?"  2?  %(  ??? ?q㿘@  ? ? ?a  @ ?   !& ?Ò@"?! /dev/ttySHELL%s -c "%s"sh㿘N -  (@ t!8@ r@ o!@z#C ެ@ 8S @ @ @ !H@jK 6@x@N!X  L@  N @@  a`@"  N 2!p@u@@ @C@@n  D "` ِ @M 㿘@͐ 7?@ א ?   @ ̐? .   4 ??   @Cannot seek to start positionwCannot create pipe㿘ƒ   X`x@  @  {?M@!8@@!@հ?@a| @ސ  @  `E 4' @# L?  ?` $  @ . :    * $@Ӏ #?!'? ?` $  @ . :    * $@߀ @ @] @  V  " @f А?? 38"??: Invalid mark letter㿘? . 1*  ? #(@^  . 1* "Cannot seek to end of fileMark not set㿘 '"3 . $0.! ^+z#԰  > & 3"G )#z԰a> & #az> & ""  ?  ?#@  㿘`?㿈  @ Bz> &> 㿈@ 6耢?z쀢? z#"#";`;`㿈 &bz ?2  ?2  c!\"b  ; #  ? ?cԀ@"" EMark not in current file㿘T  z#@ "h@ ??Input is not a pipeLog file is already in useNo log fileLog file "%s"㿐 %z  z0-0*)"# "z#䀢`"ֲQzY"޻<#䀢`z#@C 0#'# @<㿘z "cÒLine number is required after -l㿐  l'@d 2`  8@ 0{"b藐Cannot use lesskey file "%s"㿐  # ' @㿘  0){'""H@`!܀`z#: @?   H  6 0!\ e Tags file "%s"㿐 }  "" 0}"` '!@/㿘  { ""$!"h%s㿐 )  "N@0,+N@ M" m = ! !  `!$`} `!@ժ &a!* '"@`㿘   !%!$!㿘   @ 㿘   t բ Use "h" for help㿘!`    @" 0լ ؤ@f z"c} l4There is no %s flag ("less -\?" for help)㿐 'D" " J@ € $$⨀  DJ ?`0+'D#\*` €DJ@ +`?`f`d'D{ D"J + 'Dz"cI D@O'DD z?'D@ 2  @' @    "`   `, # D&     `?"N   @[`? J@  @'DD@  "@  €DJ`2J @                       @    @       ͸  ͐   There is no %s flagCannot change the %s flagCannot query the %s flagCan't use "-+" or "--" for a string flagCan't use "--" for a numeric flag㿐'H@f @'  ` @ @ڐ'  82 ! @ΐ' X@0   HJ`"  ` @ h "m``  "&   a`> 5[`"Q` "` R`" `N` `?H"` `?C"@":` "N@;`" N@7`` @`@b`?` )"@4(`$ x"`  ``H@ 2 ``  "`"@ @c 05`  €H`  @ `  "`   ``  *@> '@7``  "`؁` @  ` -%s㿘!#"`x @b㿘@n    S@ 㿘@b  ` 2`@ String is required after %s㿐͐'!(@㿘"J@㿘N = $2``*@J@  @ Number is required after %s㿐 L -2    ?А  &%?'!@  А  * .  @*`: В@ Ѐ$&`2 Scroll window size is %d linesScroll window size: Forward scroll limit is %d linesForward scroll limit: Don't use init/deinit stringsSend init/deinit strings to terminalTab stops every %d spacesTab stops: Display ~ for lines after end-of-fileDisplay nothing for lines after end-of-filePrint backspace as ^HBackspaces cause overstrikeDisplay underlined text in underline modetags file: tag: Chop long linesFold long linesSqueeze multiple blank linesDisplay all blank linesDisplay control characters as ^XDisplay control characters directlyNever ring the bellRing the bell for errors but not at eof/bofRing the bell for errors AND at eof/bofprompt: Log file: log file: Constantly display line numbersUse line numbersDon't use line numbersLong promptMedium promptShort promptPosition target at screen line %dTarget line: Ignore case in searches and in patternsIgnore case in searchesCase is significant in searchesDon't allow help commandAllow help commandBackwards scroll limit is %d linesBackwards scroll limit: Highlight all matches for previous search patternHighlight matches for previous search onlyDon't highlight search matchesOpen even non-regular filesOpen only regular filesQuit immediately at end-of-fileQuit at end-of-fileDon't quit at end-of-fileBe helpful in promptsBe less helpful in promptsRepaint by painting from top of screenRepaint by clearing each lineRepaint by scrolling from bottom of screenAutomatically allocate buffers when neededDon't automatically allocate buffers%d buffersBuffers: Search skips displayed screenSearch includes displayed screen{H  "    J2 {H⸒J   ( P  J򀠀  㿘'D'H'L@U2" @! $ D?H@|L $ " @J ?㿘"@U 㿐@.%s: %s㿘 b@ ߤ@Ő@ Л c@#?㿘!|##`@ # @C d<## . `@   d@C . 6` .`@B2`* @ *`B2*@ *@C 㿐!` m"`ؠ  M>    0  h v քJ       @ N \"  `r@9D 2   0  0 *:㿘%| "آ@z#܀`  @{ڔ "`$ 㿘!|# "؀@ a4 # չ"a4# * $# 㿘N  * : N`㿈6 2 @k 0,@wВ   -, $?L?㿘N) *`:  % `N d  s2N@L`  *`:  L`  N@ `@N 㿘!#zcܒ`"! FY c܀`q 0'|#(Q! @ 6@  q B   ?<!  "`2㿘  |T#@!! "a4㿘!z#܀ q@ #܀   0 ԣ! @  "`؀6???? |`| 08|`* 㿘7ᔴ  |c`.8ᔴc`#`(8  |c`* 8#`8! @ |??c`*`:!`@c`㿈ᔢ b؀$ |c`  @c@J#`a???aU a$#`$耢?쀢?#`*  :?|`4 ?   6?|`42 ( ?㿘! @  |`*     @ |` 2`"``"@??: ᔐ $ ᔀ6?㿘|;#h!$!|!͸#$ |ʹ#$ }Ͱ X}"`#H c܆"cH c܁%qd㿘cܔc@%d㿘cܔ@c㿘cڔ"qܐ ?( ܝ㿘? ? ?a  ?   a& ?g -㿘?. > `6U"`*` €#b@ J@ 7 C! z]c@3f`88!!Ѐ`3 6!?&  $* 0(&!0? ! 4 `  ?2    zcԀ@    T T T T T T T T T T T T T T T T T T T T T T T T T T T T T  8 T T H T T T T T T t T T T  T T T T <㿘?`6!l*` €4? V0ta0pzhczc& Aբ B 8 4`2  -?0LߞՆ ? 4ڐȞr   0$О"@ J  cܐ? "cJ? c0 zcԀ ` d d d d d d d d d d d d d d d d d d d d d d d d d d d d d d d d d d d d d 8 d d H d d d d d 4  J:" ?." \ J2 02 0?㿘N l"   p b" 0"! ?* : `2#*` €&@?&@? &@? &@a\&@&@? P p p p p p p p p p p p p p p p p p p p p p p p p p p p p p p p D p p p p p p p \ p p 8 p p p p p p 0㿐""N` 1T PN :( ? %' .2c* \c* ($cܰ c*@`!$cܰ N n 2 E N ?Zs N Ā :ܖ@ "!0  `*@ܐ@ "㿘}` 㿘!!`"@*"@  J@ @&    #\`H* *` @2* (**`J@ @*J \   J  }Ȁ@ 㿘# `4 %#!h`*%#a ?# Ȑ    @  ˒N/a?%#No previous regular expression㿘  H 0  `?"Invalid pattern㿘 X @~ݔ  1}@}<   ? Ȁ "& @& Ȱ 㿘!} Ȁ "$ @$ ȁ㿈}`Ƞ @v˜ `? &@ & 㿘} "?@} ??:$`:<- }2' }"" 42 2" 4 2 ( 2 㿘`@@ 2 ` @` ` 42` " `4 >`2`` 8>``>` ` @ 4 >`2`` 8>``>```@4 `` @8@|t0&@#㿐    6    >    2 J@ 2J@> J@ `'@`J`C '`JC `Ҁ J ̀ 㿀'PD'T A'PT  , PT "@@ 8 F :`@ F :`:`HT(N  P۔T P!؀`` 1}@'& `2@㿘#`!D"c㿈耢?쀢? ? @g 㿘!<"c㿘   ( ?"  wѻ!H`  ? a\   㿈\`/ἀ ? 4 2(<y  Δ   ?  !Ѐ??<S!Ѐ` @, $8#`؀  ؀ @ "0쒏 @ 2 `  "ἀ  Ἲ`!<` 쀥2= Nothing to search㿈`N@ , 2R H!<`% !< 3c "5&c&c1&caD  Ȕ h O? "#D "#D"#!<` "#!< ߐ???2 #\`%"X@  ?#\#`??  !<  Đ 0 !\!<    㿈#c #? 耢`?#??" #@ #`@##? @?{?O*  ; B?D #?#?? #2` ({*  ; B  ??耢 #`{*` :  b@*   * @ :`@ f #?D{b:  2 #@b  #: @ c @? @ 2#=(=#\#`  @? @4 2=(===#㿘c@{  ` "㿘’`,@z ` "㿘’`p@z ` "㿘  c@zՐ ’`,@zѐ ’`p@z͐ 0 @zʐ  @zǐ  @zĒ Line numbers turned off㿘! Q ""! @z 3 Oj  @z  @z @z@z ’`,@z Z ˖ "`؀ #%aHa  2  :  "@"؀ {b Ѐ "b "`"А!  tagsrNo tags fileNo such tag in tags file㿐}`@b "} {"!@{)f-@.v 2aL  2[ "`Ȥ @%!ž"̒'J@ K %!ܔ'J   *` ť''J`3 `)$$J@`'J@ ^`'%`J \`'  *'J@  2J@J $"*@>E0 @w @>:" %!܁Tag not found㿐 ̀ "  e5 ! ?/?곒   /-+ἀ 鍔   Ѐ"À `@{6@-Ē ἁ/dev/tty㿘Ò @VB" "`А "`Ё㿐# `В ? ?O O "/ `㿘@  ` P H @ 8 0 (             @       @ noacnfsv2porttcpsoftresvportmntudprdirplusnfsv3intrdumbtimerconnbgupdateforceunionrdonlysuidexecdevautorwrogroupquotauserquota23a:bcdD:g:I:iL:lo:PpqR:r:sTt:w:x:U-2 and -3 are mutually exclusiveillegal -a value -- %sillegal -D value -- %sillegal -I value -- %sillegal -L value -- %sconflicting version optionsport=illegal -R value -- %sillegal -r value -- %sillegal -t value -- %sillegal -w value -- %sillegal -x value -- %snfs%s: Filesystem not supported by kernel%s0@7*! #$"}a''@y3 X+})}! '}7}5};y9Ā FtƑ* @€a  Ēa@vm g%!! "`Ēa@vc   =%aZ$`"@1 J@ Ā6`"a@vL @$`8C$` ?$` ;$`"@ J@ Ā4`"a@v- @$`@$$``( $`"@ J@ Ā4`"a@v @$`( $`` @$`"@ܔ J@ Ā4`"b@u @$`<$``@ $`Ò"@n` $耊`` $` `($` ` @$`  a  Ēb @u %!@ ! "`Ēb @u   =%a$` @@` $` 2&(` $`@  $` &@ "@ b@@3 }2a @ ` $`$`H$`L$`P$`T{'"@R J@ Ā"bH@um g"""@> J@ Ā4`"b`@uY $`$ Q$`` M$`  $` H&"@ J@ Ā4`"bx@u: $`, 2$`"@  J@ Ā4`"b@u$ $`  $`"@ J@ Ā4`"b@u $`0 $`&@s@A:!p??c* & @ @c@@` 2@vp b@t  "`-ĒbȔ@tܐ b@ @vY  | 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 T 0 0 0 0  0 0 , 0 0 0 8 0 T 0  ( 0 0 0 0 0 0 0 0 0 0 0  4 D  0 0 0 0  0 0  0 0  0 0    0 0 x no : or @ speccan't resolve address for host %sNFS PortmapCannot MNT PRCMNT RPCbad MNT RPCnqnfs 2/can't access %s: %sh?' [@"H@ @ @ : @# !*@[ }@ 2Ɛ#H@s @v }!` ' ` Ԑ =$&`'   'ش ";' `'a7-a+} a9}!  o-` 5`   ؐ@,`  }a耊 2v@֐#pq!2`''` 2  ܘ @m  ''@ܠ  a耊 2L@#G@>$ $''$'' #\`@Ș`  " a؀ }!`wƒc@a@B "a耊 2ƒc@@ǐ"  @ @$? #$!}!耊  ?@ $!耢  ?ƒc@I @t @ @ly @lw @lu @ސ#!`$!@[/ < L}aa}!耊` @tː ""!Ơ#@ @} !2  &`&`&` H&`D&` 㿘'HH@!j$㿐@ J @ "`E    >  &` `@  6@]` "1 `  ?+@ ` &@N ! @@D `@"` `2  ` P`  P&@ usage: mount_nfs %s %s %s %s [-23PTUbcdilqs] [-a maxreadahead] [-D deadthresh] [-I readdirsize] [-g maxgroups] [-L leaseterm] [-o options] [-R retrycnt] [-r readsize] [-t timeout] [-w writesize] [-x retrans] rhost:path node㿘Ȓb(`"b@A!@t ,-o %s: option not supported㿘@s  @R ;'Ȁ n L  o  @ = 2*`"@ 2  }  @2   "*@ ""(`2 ȒcH@r8  @8֒@ 2L@rV㿘@ DEFRHLPXabce:f:hilnqsvwxz㿘@2 P <Jbt e l f"i hɀ`6bʐ p*`  ["cY`W`}bl R"bl}bl M"bl}bl H"bl "bB}bl @="bl 9"b 5"c$ @"1 "@ + &"c$`  "c "c  "b "b "b  "c "b "b@ɔ@=ْ?2? ` !@# #* @  #@s  @# 2 !#* @@# $## " @r # !#@x&# @    # 2 "b *#@ "  `"耢 @rÐ @r @r @r  %D %T %\ & %d & & & %x & & & % & % & & & & & % & & & & & & & & & % % & % & & & &( & & &0 & &@ & & &P & &` & & &p & & & &usage: %s [-E|-F] [-abchilnqsvwx] [-RXH[-L|-P]] {patt | -e patt | -f patt_file} [files] 㿘P <aP@?m!@rb arg_patt("%s") adding pattern "", length %lu too many, exiting ... 㿐% ʐ!a@?K@t '@Y 0*# !ʒa@?7 @;:b@?-# $ ʐ@?$b@r @5 @ 㿘 @"""!"Ԁ "" @t$  "&@""@"$""&@$"ԁmallocrealloc㿘`ؒ`""# # 7"cc @pF $c ʒc@ "#}p# *`"p @pt*` $c ʒc@  @p)` ʒc@ @k+,c *`"`"r㿐˒a@" @ @ J? '* @ @6㿘#  @o,  ʒc@Ð @,`@@q "`@ `@ %s㿘 @Y6 @oǢ ʒc@ @Y)˒b@o 㿘   @V`fts_open%s: %s%s 㿘}"l@i * ˒b@q  #  # 2 `!@ `"Ȕ@oz # "``@"`@@j^ 2`8(standard input)%s:%d:%lu:%d 㿀   ˦!c˒a@] " ː"@K "bݰ # `  Y  ?  ?? @h b 2B"쀢 쀒@29 ? 21 2-. # $耒 @ ?#\@  2`_"  "  @ #\@  2`_"  4# 6 "耢 1#$ ("䀢  # ː#@# ː#@" ː#@ߒ`@99 @@b䢒 g` @ ː"@ -"b"耢 )#$  "䀢 ː#@ː#@ # !`@ɒ" @n< @n8 !@4{㿘@㿘@.?͒`@ѐ `@j@ N ( /@`` /?"```* "`@ /`` ?"``* "`@ @o Հ ` N 2 ?N /"? .@?*N /2?  @qU@qR@ "@![ ".@Vt@oj usage: basename string [suffix] 㿘͒a@X%s: not currently mounted%s: not a directory or special device%s: unmount from %s %sCannot MNT PRCBad MNT RPCx@X? @KV h< @   @ٔh  hΐ!)@ΐ!#h @ǒ  2! @   @ 2 @  Β!@ 2@ Ͱ bX@"g  !@ @  ,@K @,@ :  @@, :, @! #4`ΐ!В@#0`2f !#<@i ΐ!@LY "X@"(  2S O#<@L ,  ? ?/7  @g- ?`'\'`'ab''d @+\ @!( @7,$ '`'x'|'d #\@!  ΐ@גb   @ @ getmntinfo㿐@A!   @!7 @64  ``@4 ` `D@nf  T2`@ T 2` `D@nP  @Ҡ! 㿘}#Ԁ  c(`?  #@!w    2c(@ empty type list㿘 N  nϒc`@kl  N  o "c( "#( %}  @ , ` @kR*  $Ԑ @, $@ , `$@  @ , 2*@, $@㿘 #8 "- @ "( @Ӓ . " *#8@ 2  @ " @ . "  *#8@   #8 㿘'HH@A$usage: %s %s umount [-fv] [-t fstypelist] special | nodeumount -a[fv] [-h host] [-t fstypelist]㿘Вa`x@9b!@lW 㿘@Grsh8KLdel:nwrlogin/usr/bin/rloginrsh: can't exec %s. rsh: must be setuid root. rsh: unknown user id. shelltcprsh: shell/tcp: unknown service. RSHrsh: can't establish stderr. rsh: setsockopt: %s. rsh: fork: %s. 㿀@+ @ ''@  /       @Вb @ " ' ,` `J@ -",`' `?ѐ#*`    " @},`В@ (@6&??!#  $#*@$#`'@d#* @ А"8&@@!@}̠"@@@}@А!bP@8@k @y@ А!@8bh@k @v@|  А!@8b@k "@@ݐА"@b 2 А!@8zb@ko @}v" )@#\@Ik#@ #@@k_   А!@8`b@kU *'? @   #@ "!#Р!@3c@8G#@ @    ! "#Р!@ c@84@}J@}P '@k  @kO  Ӓ`@kI  @kF  Ӓ`@k@  @k=  Ӓ`@k7 `2@ 6 "!#Р!@c@7@j ! #@"~@l"~@l@O`@k  D D D D D D D D D D D D D D D D D D D D D D D D D D D D D D D D D D D D D D D D D D D D C D D D D D D D C D D D D D D D D D D Drsh: select: %s. 8 PN @b#@ "" @b:$ <  @l 6* @ *@$@  @ Q 6@ " "!#Ҡ!@P`@7d@jY : ؐ@b & Ĥ΢" #ɐ@ @jB  @j ؒ  @k̐#@ 2 * +@6$ * +  $ ؒ@kJ '@     @  @ " "K6@Ґ!@7`@j 2*  :  5 &@a$  #@ 2`*@ `* *&@ @a 6* : % $@a$   #  @**@&@@a 6* : @2 *` :@`؁㿐! "/#@@ai $"rsh: %s. 㿘@   @@kt `@`@h !#Ӡ!`@{ @6@i @ @@@@L 2 `  , `@ 2@usage: rsh [-nd%s]%s[-l login] host [command] 㿘Ӓa@6W!@iL 㿘@mkfifom:invalid file mode.㿘@(H ӒbP@5 P`<@bX`? ' %+ m@ 2Ӓbh@g @!@g@@3`?倢 ?c* @ @&@ڐ `  `J`p   &``@ǐ`"!@ - @2@h@%2@hnode must be type 'b' or 'c'.non-numeric major number.non-numeric minor number.major or minor number too large%s㿐`J c b `@g  `@$ `@"J@ Ԓ`(@g ` @ ` @"J@ Ԓ`H@f ? *# 2* @ ? 2`  ", Ԓ`h@f @@2` @`@  㿘@  .!@@@œ6 6`@@א  `@ usage: %s [-m mode] fifoname ... usage: %s [-m mode] name [b | c] major minor usage: %s [-m mode] name p 㿘  #PP <!@5$bP0 !!`<Ԓbx@5`<@5b@h  㿘@;hms:r:t:/dev/%s%sopen: %stcsetattrTIOCSDTRTIOCSETD%sslip.%s.pid/var/run/w%d Failed to create pid file %s: %munable to delete pid file: %m`@&#'~)~!+-Ȁ`5Ր#*` €@@,@ @b $ @b%!@@2Z#P??c* & @ @ @`@   !#PԘh@D @D|  6kԒcp@ڐ  '/'''/@@@6  Ԓc@Ő `y@iy  Ԓc@ `@in!Ԁ Ԓc@ @f Y!֠ `@g} @gz @gh%"cH @iN@ /'1)N@ /`4N@ /"`@ H$@D\  @h@诐  &#LcH@4 c@+#L 'Ԓc@ ,H'@P#p`LH H@m"   "`Ւ`@  T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T T Tp T T T T T| T T T T T T T  pslipstrip㿘֒`x@   @`  @usage: slattach [-t ldisc] [-hm] [-s baudrate] ttyname 㿘֒`@3!@f 㿘@o_block_size_block_count_block_tableusage: installboot [-n] [-v] [-h] [-s isofsblk -e isofseblk] [-a ] 㿘֒a@3a!@fV a:vnhs:e:sysctlSUN-4sun4csun4boot: %s proto: %s device: %s architecture: %s sun4mUnsupported architectureopen: %sproto bootblocks too biglseek bootstrapwrite bootstrap㿈@%)!+7)#%5-'/%耢` א"*` € "$  %` &【 %#| @b~ "b @b~"b @0b?ؒ?& ~* @&x %   `%$$#   '''  @^ ?֒b@   ֐b @  "0֐"($ #| x@U"8 @Q"H$@M"X @I"h @0 %` @wb(  @qb ֐ %`b@c  @ƒ $@ev  @Bj x$b@Ȑ @ڒ @ed @\　`2"@$֒b@cҐ  @BI $b@  "@\ 2րb֒b@ @p@\耢 ֒b@ @\ [P [ [ [ [ [ [ [` [ [ [ [ [ [l [ [ [ [ [ [ [ [xnlist: %s: symbols not foundnlist: %s: wrong typefstat: %smalloc: %s: no memoryread: %s%s: invalid address: block_table = %x%s: invalid address: block_count_p = %x%s: invalid address: block_size_p = %x%s: entry point %#x %s: a.out header %s left onstripped offproto bootblock size %ld room for %d filesystem blocks at %#x 8~!ؤ@В א#     "   א#(@R 0@A ֐"@ @fr א#@@0HȚaB + cB + 3`  *`  @6  א#P@'01@\: Ȁ̀ג@#h0@[`      a,c?   ?# ! ? ?#   F?2B  ?  ?# !  ?0@! *? ?c@  ̀@ ?@ ̐ ? ?c@ ! @  @!   #?9 ?  ?# !  ?/@! (? ?c@  ̀@ ?@ ̐ ? ?c@ ! @   @!  2 ? ?# !??? ?c@ ! @ ?%" @!  ?" "  ?c@ ! @  @!  #? "? ?c@ ! @  " @! @" "      @ # " "cג#x`ג # ג #@@aߐ@Z̐3 c|"  @ې# ؀`  ؔ (@ΐ ؒ@ʐ 8  X@&@ @a &&  `  %s: devread: lseek%s: devread: read㿘. >@Z 2ـ@ْcP@B @Zْch@7 statfs: %s%s: Too many blocks%s: %d block numbers: %d ffsufs%s: must be on an FFS filesystemfsync: %ssuperblockNo memory for filesystem blockinode%s: block numbers: %s: block numbers (indirect): indirect block㽐@? ֒b@ @ ~ڒ`@א b F #""~ "" ` * "`  ڒ`@`ڐ #|`ڐ (@ ` @|'%", * "@ |  @@` @"| @ H04ڒ`P@   ڐ`X@  ڒ``@` @/1 ڒ`@q @c גc@@h @Ycxڐ   @`{0 ڒ`@`t ฐ@e@fG༠@e* @f? @f@ex`ڑ* d0 Ȑ, ߒ@frxc* 0@"0 ;  @ C@#8   @ ڒ`@`3  "@|  ڐ @\ ( (  `|3/d,`*"@ |  @F@   `2d| `@4 H`>| ڐ @+ X0!}t|+)d,`*"@ |  @ @t `2d| `@ H`ڒ`@_  㿘@eroute: botched keyword: %s usage: route [ -nqv ] cmd [[ - ] args ] keywords: get, add, change, delete, show, flush, monitor. 㿘 !ےbx@.!!ےb@.ې@. b@a route: %s: %s 㿘 a"ےcX@- ےc`@-!۠#h@ِ@-@` nqdtv/dev/nullsocket㿐@ ' /+)'#%!795;- * p@€ %c  %#  $Ȑ $c $t @+]#؀??㰓* @ @`ð&@'"xc`&|c@= %̐  @~ %̀ 6@c@ @B?`)ܐȓ*` €&|@;'&|@U0 @ >@0U@@`e qx q qx q qx q q q q q qt q q q q q q q q q q q q q q q q q q q q q q q q q q q q q q q p p p p p p p p p p ph p p pt p p p p pmust be root to alter routing tableroute-sysctl-estimatemallocactual retrieval of routing tableExamining routing table from sysctl (address family %s) route: write to routing socket: %s got only %d for rlen %-20.20s done x"| `   "bސ"b̮ @& B .`@J@ -)@`?`#ݐ#*` € ,"cT ("cT $"cT  "cT "cT "cT "cT@ b#!ܢa@#p@,ܐ#@B0   ?''''   @X} 6"܀ @] 2s#  @Xd 6f#ܪbȀ  @#0cT @#X@`` [-"Ȁ " @  ,J#T` L ` 2C ` >"t`2; , ̒@V$ #耢`*"Ȁ @ ]# #`@m@T@ @ `? @`@[@c@ "@] td tt t t t t t t t t t t t t t t t t t t t t t t t t t t t ( Q(( ~:* b0  .*  ?** *`(defaultinvalidiso %s(%d) %s`~bԀ  "bԤ"@ ! 2 ,@ . @` ,  2  :a?`ߐ $*` €  ' `ޢ `#`̒ @  @{ . b@8` ",@!`̐@<'@!l!#`  !  ???ؒ'@_P  /Ѐ/؀``ِ  `!ِ    耢 !/'/! Ф!#\! @@ -ޒ`@!(!@d$@ڐ @* !ޠ @4 #a@;!!ޠ ؤ #a@; !!! y { { { { { { { { { { { { { { { { { { { { { ztaf %d: %sh ?` ߐ#\*` € ޤ (!#`$! 0?    ??   !:@ 2:@` 2``2 @.Ò  2 `#'@n@$!l##`  !  ???ؒ'@^  /Ѐ/؀``ِ  `!ِ    耢 !/'/! Ф##\! @@1 -ޒ`@B!(#@$@  @);!ޠ @38 #c@:I! !ߠ @#c@:;!# |    ~ ~           ~     ~ }㿐 `$' ̓*` €#\ #` #d #h #l  #p  #t @#x c " cX "cX 2"@Ȑ$  d d d d d  d d d d d d d d d d d d d d  d d d d d d d  d H X d ( d 80%s,%sold usage of trailing 0assuming route to if old usage of trailing digit, assuming route via gateway %s %s %shostnet: gateway %s (%s) not in tableentry in userouting table overflow: %s 㿐"|a` ('5  &2"@M@ g"?b@v ? '/#7`@J@ -@ Ӑ``-*`! € ~   ~   ~  ~ * ~  ,  ~ "T"p $p 7$ "c "cĐ %  !"(?2`@ @ ?2`@ @ ?2`@ @  ?2`@ @ @ w??2`@ @ @@i?2`@s @ @ cܐ [$cܲ`@@?  $cQ $cN ?2`@X @ D?@P #쀊    @6  @z0?@p ?耢 @@ /ah  !pax@ & $p  耢 2$p@ސ!@ې!$p@ @K ? 4`Ā 2 c܀ 2   p "  3'cT 2$M@M " M@`"M@` "``@\ &M@@  3߀ cTM@ g@Z 1!!" @M` "@z` #T` #!"'@Ҵ@f  @`" `" `7`"0 "0 "("8"H@@F"`@  $ H ` \ h H 4 X 0 H h 0 <  X | P쀢   '  ? ( ?* ??* ? *  ? ???"`"`(*``H 8 *@64128㿈    2   2   2    2 !h    ?? @4  "Ж"؀ `@"Internal Error%s: bad value route: %s: bad value H#T`~  #""Tc?T "c#$* €"##"D#(  T b,#" ,`,@  ? "',   0n  0kܒ "ܐ  b ,`"ȓ*` €  ?ؐ ??? '''ah@B  ` `  !c@&d@YY ` @Z|? ? ? ?    $4  @֦ 0 ~"`"2c *2 $c2 2 2 2 2 2 * #@@l Ȱ 444Γ*`4Ѐ`4 4    ~ "" 2 c2` 2` **`$c*`*`*`2`2`2` 2` 2`*`#@@ *  ,,,,,, , , , , ,`,  @.@Y   2   ,@"@ J@ ""@ ,@$Q} @ >  @sq ,,@j "&@ /   @@ ,@?   @`N ,@@? 2$#܀` $'@  7 @+? "Ā`@*/   !   @ '& `  ,`` @YW0 !c@%2@X'  t T  @ h X d p | 㿘@ # ` "#!c@$@Wڐ  *ㄒㄔ `*`"`>  $`$` $`  @YY?#:,쀊    "  (*( ( *.**.0x%xany*0x%02x%02x%02x%02x%02x%02x.0x%x0x%x.%s%sH 7  7 7 * 77777+  2+` 2 2,2 211D  `@0=~"ޒ@2^  ~ А"ؒ@2T  2  ؠ #` `    #\ `@,2 a@/К1 @4a!2*.0x%XH%02X%02X%02X%02X%02X%02XH.%XH%XH.%s%sx ? / / // 7  / / / / / / // ////2 2 2씓211Z !Pb@쐐0S~"@1Ҕ  ~,  А"@1ǔ  2  , 1#'%# b #` b  #\ `@dLb,`01#%    K 0 *  2b@Hb!P,b!Pb@3!2actual retrieval of interface tablex   ?''''   @Oh 6j"܀ &@T 2^#  @OO 6Q!Hܢ @*@Tgot message of size %d on %s㷐"t "b@V% )'"̒@MԔ(@ '@h@|Đx@X"uwriting to routing socketroute: read from routing socket: %s 㿘  D"b  @W"L a c  g  #(    5  & *+#(5X#X `$ ``" ` " `* `" `" $`" (` " ," 0" 4" 8" <" @" D" H*  " @쀊 % " ?   b@VbȬ  @rc(쀊  # ?   c@VȀ`@Xc(쀊  # ?   c@VȀ`@>c(쀊  "D ?   bD@VlȀ`@$c(쀊  #( ?   c(@VRȀ`@ c(쀊  "Ѐ ?   bА@V8Ȁ`@c(Ȣ% 5@H"t`25 b̦ @L  @##0'?2% %̒@L"L  `@`x@̀ "!#!@¢cP@!֒ @ ?(@J@@"@ +#쀈8|(b # 4 # (? * ##"@  ? @@ *@b"( t t t t t tRTM_IFINFO: iface status changeRTM_DELADDR: address being removed from ifaceRTM_NEWADDR: address being added to ifaceRTM_RESOLVE: Route created by cloningRTM_OLDDEL: caused by SIOCDELRTRTM_OLDADD: caused by SIOCADDRTRTM_LOCK: fix specified metricsRTM_MISS: Lookup failed on this addressRTM_REDIRECT: Told to use different routeRTM_LOSING: Kernel Suspects PartitioningRTM_GET: Report MetricsRTM_CHANGE: Change Metrics or flagsRTM_DELETE: Delete RouteRTM_ADD: Add Routerouting message version %d not understood %s: len %d, if# %d, flags:metric %d, flags:pid: %d, seq %d, errno %d, flags:㿘"Ȁ`D `" @z^#0;~* @zU   "  2  @zI ( ~!`@ @ T0 @z; 8 ~!`@x @ 0   P@z+ ~ !`@֔x@r route to: %s message length mismatch, in packet %d, returned %d RTM_GET: %s (errno %d) destination: %s mask: %s gateway: %s interface: %.*s flags: %s recvpipe sendpipe ssthresh rtt,msec rttvar hopcount mtu expire%8d%c %8d%c sockaddrs: 㿘!!y"@yĐ     !@ c0!a@    !#!@a @0  L 39-~/57+;  #" "  @" ` @  2 @ ` 2 @ ?` @` ܀ `` `,` !"@y[ #c $c!" @yN$c`   !"8@y@  "P@y9 @y7bh x@!`@y0x $ 4   L@y' $  8 L@y $  < L@y @#@V ! $ @  L@y  D#@V! $   L@x $  , L@x $  ( L@x 0`" $@  0"@& 0 $b 0   L@xݐ "Ȁ`" @%0?H@xА"!` @{X ?`$ !` * '!`@b  locks: inits: 㿘@x#8!#~ $!`c0@X@x#H @Q @  L sockaddrs: %s㿘`@@x#a` @8X ?`$ a` * $a`@  %ꀌ"$@xo ?  @ a``?"`a` * $a`@ @Iia`㿘`Y ?>@ 6  , < ?`&  @  * & @ג !  ?`&  @  * & @ 4  8  ?`&  @ >* &@ǜ >㿘  " @$ 2  %s: link %s; %s: iso %s; %s: inet %s; %s: inet6 %s; %s: xns %s; %s: ipx %s; 㾀 ?`Z*` | €!"@)*!"@'& $ !'"@!"  @! ! " 7 7 7 777@\@w# ! " / / / / / / / / / ///@]<@wn@H!` L h h h 4 h h h h h h h h h h  h h h h l㿘@@ @R-    `А *`: ?А *`: ? *`: ?ɀ`2    !,  €* ,`  *  **".@ $OpenBSD: show.c,v 1.21 2002/02/16 21:27:37 millert Exp $UGHRBD M@dmCXLS1@2route-sysctl-estimateout of space sysctl of routing tableRouting tables x  %  `@J@ -̐`?` ȓ*` €         @   ?''''   @H 6@"@Oې  "@NS 2@v"@Oΐ   @Hƚ 6@"@O @@vm"؀`@  L 2@K @NK L T d t l t | \%-*.*s %-*.*s %-6.6s DestinationGatewayFlags㿐ahp#\#`!@X   @v %-6.6s 㿘 L   @P" 2  @ $ @  L ?  M@ P @   @Ga``?"`` * "`@Ń InternetInternet6XNSIPXISOX.25AppleTalk %s: Protocol Family %d: 㿘?`#ؓ*` €""" " """ `@u#0#@u P h t \link#%d%s%x:default(%d) %02x%02x%s %-*s %-*.*s  x x  "9 u "C o     2   `8@H   `   @ w`@)'@@3 H `@ P`h@d `^ XʐXT `  `  `   `ﱐ X@j : 4@P/@P*&  @`` z:)'@Ԓ h  @̒p * x@t0#` @t0 @t pR"RЀ` "RR@"` `*`R@  *@t xresolvexnsx25staticssthreshshowsendpipesarttvarrttrejectrecvpipeproto2proto1prefixlenosinostaticnetmasknetmtumonitormasklockrestlockllinfolinkisoipxinet6inetifpifainterfaceifacehopcounthostgetgenmaskgatewayflushexpiredstdeletecloningchangeblackholeadd㿘 @N *  *.`.@L p r h2*LN p"L rL h p h r .`2 ` .` L p h r p h뀢 pL ,r  L`N `,`%`* :  . :2 ^ @56`  .` А 20 .L ` `,* L A 6` L``* @8``6`L   ,V` "6`L 2V`!  `   L`,@L   V` 2 &6` J\2 J/7$ !*@J ЄД ** 8?А ?Ї+ 8* Ѐ4*@*@ 㿘@5C/LtenexEebcdicimageIbinaryAasciiusage: %s [ %s%s | ] Using %s mode to transfer files. %s: unknown mode. TYPE %s %sTYPE %s㿘 !!@"D@IaL!`L"D @<aȰ `!"D@!$€  "DÒa@%5"!l"L`"@` 2  2  "D`@b?"al J  @!"   @!"0  @g" "!"ainternal error: unknown type %d.㿘!€ ! %4#8 `"$!"L"L` "2  #@n0͔#J# @!i"  @!d"0 "$$!type㿘!b"`H 㿘!b"`> 㿘!pb"`4 We only support %s mode, sorry. 㿘"D͒ax@q?"alWe only support %s format, sorry. 㿘"DÒa@[X?"alWe only support %s structure, sorry. 㿘"DȒb(@D?"allocal-fileremote-fileusage: %s local-file [ remote-file ] STOUSTORAPPE㿘 'D'H  'D` &`D  D@=ڒH D  DD@=ϒH D $ HH"D@b ``@?r` H?D"al`"H`""`H@J a "L """  #L  @`H"`   8 H@k H"`H  @  @"H @IFlocal-filesusage: %s local-files Continue withmput%s: not found`'H 'DD@=RH HH"D@`?u"alH͐ "#"ؒcH@J '@ " H "!! H@> y! 8J  #\  2J J  @  "J  *` /#\    H+  * *` *#L @$  8 @ "L ""؀   p    @!!! H h 1 p & p!@>a ! $!& pH @= 2uLD Ĥ #X M! H@= #L H@  8 @\ "L ""H   p  @! !! D h  1 p& p!@=a ! $!p& p  ,@KH, @V  HȀ 2 H@@! @YWD QL! DH@= >#L "@ ` 8 @  "L ""@   p  @! #a 2  h ! p $ p!@=Ra a $a$ p  @YbD?@I5 "!r+w㿘h@( w㿘#P#P`#h#@ usage: %s remote-file [ local-file ] local: %sRETR㻘 'D'H   'D` &`D  D@;H D  DD@;H D $ HH"D@c ``@=#` H?"al ;! 6 J  #\J  @  "J !   *` /#\    H* +  *` +H"   #L H@ g H"`   8 H@  H"`#H@%L   (H`@ (@:PHH @=?  H H` ` @ @$  :P@@F㿘@A !"D?`" * " @I "D@?)!  h !#"ؔ  pcH$ p!@<$cH $ p$cH @, $cH%! @& remote-filesusage: %s remote-files mget㻐'H 'D(D@:H HH"D@`8?"alH͐ "#"ؒcH@Gѐ '@ܐ nÀ h"!! dH@; _! N` #\ `   H+    +@J`*#L @ x  8 @   #  p     @#R 3a  h 1 p & p!@;m`P "& pa &a& p" @:oH 2N@GU "!onoff Connected %sto %s. and logged inNot connected. Connected for proxy commands to %s. No proxy connection. Gate ftp: %s, server %s, port %s. (none)Passive mode: %s. Mode: %s; Type: %s; Form: %s; Structure: %s. Verbose: %s; Bell: %s; Prompting: %s; Globbing: %s. Store unique: %s; Receive unique: %s. Preserve modification times: %s. Case: %s; CR stripping: %s. Ntrans: (in) %s (out) %s Ntrans: off. Nmap: (in) %s (out) %s Nmap: off. Hash mark printing: %s; Mark count: %d; Progress bar: %s. Use of PORT/LPRT cmds: %s. Use of EPSV/EPRT cmds for IPv4: %s%s. (disabled for this connection)Macros: %s 㿘!"H"D##0 !@Z "D@!#@" +@+_ "H  "DcP@B0"D@ #x@+M +bDc!!J 2#"В@%bD!!#@bDcؔȘ"X@`bD!! #P p#X@bD!"LϠ @"@bD!  h@ݐbD!!  x@Δ#L  bD`(@–$bD@  8  bD`@)bD@x )"D!#@!"|`@"D!# p!H@"Dahf! ! ! @z%D "D@@!D ¢ Ô"D@ @eaD `"!lusage: %s [ on | off ] %s %s. 㿘  `? & `@{b耢   & `@ob  &"D@@/b? "D!"(@ Bell mode㿘P"alEPSV/EPRT on IPv4㿘 P"al"Packet tracing㿘"alusage: %s [ on | off | bytecount ] %s: bad bytecount value. Hash mark printing %s (%d bytes/hash mark). 㿐  #@ `?:"#@"D@)c`@b耢 ͐ ("c@`@b 2`"#@@ #@J  "D``@?!"al͒ """@31"D!c@_ (@|c@ ""D@s`@"D@= Xc@"!lVerbose mode㿘 "alUse of PORT/LPRT cmds㿘 "alProgress bar㿘`"alInteractive mode㿘pٖ"alusage: %s [ on | off | gateserver [ port ] ] Disabling gate-ftp mode - no gate-ftp server defined. 㿘  "D@@b?`"al  ! `?,"! `@&b耢  ɐ "a `@b  "!!@H`"b!"`!@~ɐ "a"!! ! "J "D@c$!"D#!!J 2#"В@!"!lGlobbing㿘XA"alPreserve modification times㿘-H"alusage: %s [ on | off | debuglevel ] %s: bad debugging value. Debugging %s (debug=%d). 㿐 "D@'a+`@ˆb耢 ͐ $"c8`@~b 2`"#8@Ɗ J "D`a@1?#"al#8 `?"#81#8 a a ?"a"D!#8!#8@#8   "!lremote-directoryusage: %s remote-directory CWD %sCWD command not recognized, trying XCWD. XCWD %s㿘'H  'DXD@5H HD  H"D@Ւcp?%"alH`@#``!l!`! H"D@#H`@n#Ȓ`͐ "cDusage: %s local-directory Local directory now %s getcwd: %s㻘  "H &`  "D@@``@7` ?("al@]t`  `@ ?"al@,$  "D`@h`@!"!l`@@usage: %s remote-file DELE %s㿘'H  'DD@5H HD  H"D@9b ?"alH`@"8mdelete㿐'H 'D(D@4H HH"D@`8?I"alH͐ "#"ؒcH@B3 '@> -H !&"!! "H@6& "8@! H h 1 p & p!@6bȀ ! $!& pH @5 2N@A "!from-nameto-nameusage: %s from-name to-name RNFR %sRNTO %s㿘'H  'DXD@4vH HD  hD@4jH D  HH"D@`p? "al`@G H`@@ -usage: %s remote-directory local-file nlistNLSTLISToutput to local-file:㿘   &`  !p&`   "D@@Wax@@2a !!`!@&!p " `@5` 2`?1"al!p@ `J |"`@5` `@5V! ? "al``㐘 @ @8"D`@?@?usage: %s remote-files local-file 㿈'H  'D(D@3H HD D@3H  DH"D@ ߒc`!H*  ?ap''"?@ HJ |H@5F @4! H?P"al͐ "#"ؒcH@@ې '@ !+  a w/H,`@! @ 3a  h 1 p H& p@@4! a &a& p!` D?@Ҁ`@@ "!耢@@? SHELL/bin/shsh-c%sTry again later㻐 @@  @@~ @[^ S @7֐   @@p  @@m @A9!آ !@u5 / " -/ @ڔ#@ a耢  +/#8  !"D@"D@>a @7"D  #\@d˘ @dŔ !@?"al@? @%@@ @@ ?@n""!l"!lusernameusage: %s username [password] [account] USER %sPassword: PASS %sAccount: ACCT %sLogin failed. H'H 'D D@2HD?  H"D@ c?U"alH`@_ ( 7 D  H@ 0H"`D 'DH`@K @ # D H!"D@S H@7A"D O@G@AL?,H" D 'DH` @) X  "D@5 `0  D 2 ?H` @ XÐ?"bHPWDPWD command not recognized, trying XPWD. XPWD㿘!! $!@"0 2$!!l!2 $!"D@"8@"h$!Local directory %s getcwd㻘@)$  "Db@ @""!ldirectory-nameusage: %s directory-name MKD %sMKD command not recognized, trying XMKD. XMKD %s㿘'H  'DXD@1H HD  H"D@ גch?"alH`@# !l!! H"D@#H`@s#RMD %sRMD command not recognized, trying XRMD. XRMD %s㿘'H  'DXD@1dH HD  H"D@ ch?"alH`@@ !l!! H"D@D H`@+ command line to sendusage: %s line-to-send 㿘'H 'DȐD@1 H H"D@ Na?"alD @.Harguments to SITE commandSITE㿘'H 'DxD@0H H"D@ $a?"alD"@H㻘@$`@?ߐ  $" @沐 @?Ԑ    *@ . !/@ @- modefile-nameusage: %s mode file-name SITE CHMOD %s %s㿘'H  'DD@0H HD  D@0H D  HH"D@ `?"al` (@_`SITE UMASKSITE UMASK %s㿘!!  $! !@F`$!SITE IDLESITE IDLE %s㿘!!  $!!`!p@,`$!HELPHELP %s㿘!!  $!!!@`$!㿘!"H  @ @"b "H  @ @=> QUIT㿘#bH @"h!#T "@"?"cD$#T$bH" Dusage: %s [password] Account:㿘  "D@@ b? "al2`@ "@ X㿘@6 " @" "H  "a"!@" Ȑ @ ; commandusage: %s command ?Ambiguous command. ?Invalid command. ?Invalid proxy command. 㿐'H 'DАD@/H  HH"D@ cPH@(f ? '!"D@|#@4j"Dh"!l !"D@m @4["D2J`  !"D@` @4N"D%@ Ő  ch@< @! J "H !"D@A#@@4/"D@! @< ?("al"`@@^  `@>."@5ؔDH? €`"H  "a"!@!X @:#PSYST㿘@"Limit of 16 macros have already been defined. macro nameusage: %s macro_name Enter macro line by line, terminating it with a null line. macdef: end of file encountered. Macro not defined - 4K buffer exceeded. 㿘! D'H 'D"D"  DD@+H D  H"D@֒b p "D@# D#Ñ*`H * b@n  DĒ  p"@ "D@#Pz"!l" " `$ Dq"l*` *  @* *  "@ Db* * ` @'%Ȓ`? "`@Ӑ   "?̑. :  .@ Db*` *   @ƐN "Ė.@`p@3a`? "`@ a  &a ?23?a`?  "`@  3a  ` &a"D#x@ ?"alfilenameusage: %s filename %s %lld 㿘'H  'DD@*H HD  H"D@b?"alH @, ?  H"Db@"!l%s %s㿐'H  'DD@*H HD  H"D@ݒb?"alH @, ?'H"D!`#@ސ@@Ô"!lSTAT %sSTAT㿘   @ j`Local file "%s" is newer than remote file "%s". 㿘㐒Ĕ? "D``@`PAGERmoreCan't allocate memory for $PAGER|%s㿘'H  'DD@*=H HD  H"D@hb H @+  ?@"al@8R!H L !P@9@5  2aX@5 a@)#P %'  =#P@$@H$   h @.@5Đ< H=#P$@$ @@5?verboseuserumasktypetracetenexsystemsuniquestructstatussizesitesendportsendruniquerstatusrmdirrhelprestartresetrenameregetrecvquotequitpwdputproxypromptprogresspreservepassivepageopenntransnmapnlistnewermsendmputmoremodtimemodemlsmkdirmgetmdirmdeletemacdeflslpwdlesslcdimageidlehelphashglobgategetftpformexitepsv4disconnectdirdeletedebugcrclosechmodcdupcdcasebyebinarybellasciiappendaccount$!macro nameusage: %s macro_name '%s' macro not found. ?Ambiguous command. ?Invalid command. Not connected. 'H 'D  АD@)H   H"Da  1 D HÒb  @ꊔ 2  D0H"Da@?"al̒b@˃/Ò,`* ` @ Ѐ#c\  2 N+ Tb*`:  $ \"B A c\@  %*`    * ,  * :`  ?D?#?H,  @:H :  i2D  H,@(H@7@.@`N 2 N @!.@#bP@!M `"D@b"Q"!l2N` "D "( "H  "D"@@K?9"al! !"D@?b"D@3 bP!` €!#P N`  "D`?"``@* "@@ ̒@ʼ"@!)!bP'D@'H* `@2 6#D#/ÁExtra `@' characters in usernames and passwords should be encoded as %%40unknownCan't allocate memory to parse URLhttp://ftp://file:url_get: Invalid URL '%s'Invalid URL (no `/' after host): %sInvalid URL (no file after host): %sInvalid URL (no file after directory): %sCan't allocate memory for proxy URL.Malformed proxy URL: %sCan't open file %s-Can't open %sWriting %sReading from fileSuccessfully retrieved file. host %s, port %s, path %s, save as %s. %d%s: %sTrying %s... socketconnect%sRequesting %s (via %s) GET %s HTTP/1.0 %s User-Agent: OpenBSD ftpRequesting %s Can't allocate memory.80GET /%s HTTP/1.0 Host: [%s]:%s %s GET /%s HTTP/1.0 Host: [%s] %s GET /%s HTTP/1.0 Host: %s:%s %s GET /%s HTTP/1.0 Host: %s %s Sending request: %sWriting HTTP request200Error retrieving file: %sContent-Length: Reading from socketRead short file. Auto-login using ftp URLs isn't supported when using $ftp_proxyImproper response from %s?'?#"@@x?c@"@  c @2q ?cH@F  ??#* cP@6   ??#  cX@%  ?#   #c`@28 `@ܒ /  L@ 2,@ 2.#` L@  2!#?#"@ %?!?#@"@%?   J  ` #@|50=`@$ `@1 cH@    cP@    L  / (@|0c,@o / ?L@ 2,@?c@@`$@/ 'Ԁ?? @@{0E#H@@5?2 0??:x?#@`X  &@!'Ѐ ?R!n'?c" @C!@ 2?`@3- bԘ ?c:# ̔  ;a@)3?O?@B :& В@*?怢 2#@ 7 24?! +!2 @&"D #`?"``@* "@@  #"Ԓ :@ F @(@*e"D?#ؒ@Ԓ@*M 2#@ H C!`!<  8"! :` !2 "D?`"@  #* "@ #"D?`" * " @ @*"D@zϐ 0Z@( ! #?"D@ #?c@2d @)R!nЀ c@)c ? @0?L [@g ] " J ``:2* @g  : , #8  ?#@D`@ؐ @3}  ''"!?#@`"`#(  P@@  ! @K @zu0Q?#?'ԀJ!??cؠ  #\  @"D`@@Ӆ 'Ԁ?'!@ ? " @)?'a㸔   #\ @q  !??!?#@Ԁ !@y0r# ! "Da@T#0!H@yf?! "Da`@@@[ : 5@ڧ ap@/ @M % 2*a@ aH##\@F0 ?#@aH@9@/$?a@ aH##\@"??#@aH@?#ؒ@@2c8`"Db0@ՔԒ@(@yN"H0ِ @2P??#ؒ@&0:./Ԓ@(g  L   ./@ʒ  b`@  "h@yP0 @2" Ԓ@(?  L  2 `    ?#ؐ/ ?cؐ */L   H* R  c2 b@  2 L (  @y?c _' * @ :  !x:!x!x ?P  K?#J F???:x?#@`X &@ !'Ѐ  ?@x `0*R!n'?c" @L!@  ?#@ @ @00 0`0@0, bԘ ?c:# ̔  ;a@&2?O?@B :& В@'?倢 2#@ 7 24?! +!2 @&"D #`?"``@* "@@ #"Ԓ :@ F @(@'d"D?#ؒ@Ԓ@'L 2#@ H C!`!<  8"! :` !2 "D?`"@  #* "@ #"D?`" * " @ @'"D@wΐ"0Y@% !x!x?̔!! @ ! @"D@"0:! #?"D@ #?c@/G @&R!nЀ c@&c "? @-?c@@@- 0'@w"0 ?#@@wz p0#@wԀ??@&v?#@ "?@ @-}?@-x? http fetch aborted. 㿘@(W !"D@ @&"D!@@  file fetch aborted. 㿘@(C !"D@ h@&t"D!@@ ftp_proxyhttp_proxyCan't allocate memory for auto-fetch.Invalid URL: %suser %s:%s host %s port %s dir %s file %s Can't connect or login to host `%s'cd/*?[]{}Retrieving %s/%s %s/%sgetmgetp'D'H'L!'@  "H    'a@. 'b @. @/K @/G Ȯ ܦ H* @@׳   `@, cH@   cX@   L?h0dcP@q  g L?W0S /@- :@)@% @ < :8`5`*  @,@ @ @ 2@v#0  M L  H*` @v!0@<@9`@ : `. @Ӓ :`L@ `.@``N@  @b /  * #8  "Da#\#`@#@f 8@"H  7 P <'''耦  N !'' !Ā  <$ < @"H  $ <  @* 2 !@@v0ᮒ !hap? 'Y#D  #X  ` `N@ ax@T@ ` `M@ ax@H 2 ``N@ ``!h' ''%#D K`"J?M@ D?!  "D`!! @` @ $!''䀤` '耤 L! p!'$ p   $ p " ''  ϒ!l@  d ܰ @+Xܐ '܀ D 6 ܒ :H* @ `"H ? _ Can't allocate memory for URL decoding㿘 < @.]@*   a@tא  + L +  ,@ %2,@#\   D ",@   D @,@ ,@ L ۢ`$@,@ \` `(8 (\8` (`8Б(: :/㿘cP@v  cH@o  cX@h  @bЀ   unknownftp%dftpgatehttp%s: bad port number `%s'%s: %sTrying %s... socketconnect to address %sconnect%sgetsocknamesetsockopt TOS (ignored)rwfdopen failed.Connected to %s. setsockopt@¦#X"a)Ē  @-H Hؒ  @-C  ''''@|{.`c`/@݆ cp@݀  h @Ė Ocx@r  Oh @ PO @|M` !#@t'  #@@t?"al ` @ ! @! %$ G?     #\! @; "Dc@>  @ 6 %#@{   " " ``     #\! @ #@s@"cز?  `6  @s#’?@c"lw  H @, @Y'Òb'@# 6 @sm#E€  '  @   @sZ#`@!$#<` @#<#̀ $cT`2@st (#<! "D`8@@ #< "cT@?cT @9?"al '?c!@ܘ   #8 @s P!@" 㿘@$  !"D?`" * " @Ð @"1"DHcL `"HÐ"x@ ---> PASS PASS XXXXACCT ACCT XXXXNo control connection for command. QUIT㿘#8!'H'L'P'T'X 7$#H3bD@!H!@ޔ  bD@"bD"@އ  bDbD@"bD@͒bD?`" * " @W @!bD3cT  @r"(?"al& a`@*! cT@HcT@"P@!cT͐ "@ƒbX@%`?#H ƀ @* %c%c%c421 Service not available, remote server has closed connection. %s:㻘ˮ! @+@$9 @)ݒ!`    ¤"!l ֦ '@c#<`΀` `@c# 8@!,"D!"al ` >!`4€5 541!耢 ,!  À` "D"D`@A"D`? "`` ,`:  @* "@@y #\ `   l*` * ?А"l  !l?    !l " d  #\ `  2   d` `)"---  d`("  `- "!l "!,!@b#<` '`! 4 !À? 5!耢 !"D`?"``@* "@@@ h"D $8$!ؒ@K !l`"# 1,""ܐ @(!l!a@'#H  !`@`"?П@  ?ƴ@(  "al 㿐''   @= send aborted waiting for remote to finish abort. 㿘@!Ԑ !"D""H@"@ "DÐ"@ sentlocal: %s remote: %s -local: %s%s: not a plain file. STORAPPEREST %ldr+w%s %snetout" :?x"'l̔  ?? t8;ax'D'H'L'  LJ -"Db@L`"Db@L" DH@ L0a!   '''` ''t@" / "܀ 1#D @@?&#D @'א  @'А  l@'ɐ l’?" A"lb<@' '!cT@' 'H@lb  H!'`"c"0aJ@ |( @' H'`@Kx' #@o@' @' @' ` ""`a!'07H@ڒ`' H@oː"@'p @'m !'@)R  <  "H"D@,b@'S @'P @:x@~ @'A @'>  ?@'7 ?"ll"`@;" d1#P#P`@QD@גb  D@Вb耢 EL! ?` @    #PR  @d  1H@oL"  :Pl G"#P u"    >#Pl 7"`  >#P'tLD#\ ,@&Ɛ @&Ð l`" J# @& @& l`" @&  "@pt@ 4' @? @& a'`7`` ""S ! >`B;!` R @ 4&@#@ ; !x 3!!x *x  | !|"D #`?"``@* "@@c #"Ԓ :x B?x!@"DpR @$ #@ M` !x C`!`!<`  8`"! :` !2 "D?`"@  #* "@ #"D?`" * " @ @n"D`H@n+" "]#@3 !!x 8x  | /|"D #`?"``@* "@@ʐ #@7"D"͒ :x#@ B?x   !x  @; `?"``@* "@@ `B :`? "`` .`:  @* "@@`B :@_R` #@ B !x :!!x x | |"D?`"@  #* "@B #"D?`" * " @2 @"D @H@m[" @  " @mO#̐??:@ l`" @@L @$ߐ @$ܐ  "@$Ր !`!M  I@ 0E@$Đ @$ l`" @$ "܀ 1?."al#D @ ?&#D @ ? "al "@!`!  @}  receive aborted waiting for remote to finish abort. 㿘@ː !"D""H@ "(@"DÐ!@ receivedRETR./mallocnetin%s: short writeWARNING! %d bare linefeeds received in ASCII mode. File may not have transferred correctly. Can't change modification time on %s to %s"'H :''X''?'T”??'D̘  :!x t;'L'P'Xb'@ջ`?'܀ #!  H X HJ -"DbH@L`"Db@L"  ܀ HD@ L0T' x'䀢 ' ܀@ '@ϐ!؀ +Ґ "܀ !#D @?$#D䀢 @# 耢 X@# X"`T?""lb`@# '!cT@# X'耢 H@;b lHJ |gH@M  UH@XF / "   H@k"0m 2,H H0""@)   /,H@k"0O"耢  "  H@S! H@k"0;"耢  " H@ w'HH 0*"耢  H@ j'HH ܀  !   0a!   L@ :x@4  @" @" ?w"al@!؀ #܀  #P`#P o" cL  D#d  0\# 0@] ' X 2XH@pb X!`'5"``#HJ | @" 'H @F}` ' H#@j`0` ""`a!"`H@P' H@jؐ"0!'h@$/R   !$'!!@#a @ @  $a@j"$!$!p<  ` ""`" @^?! "  P P    PR  @  ""^  aR @@2  "   $ Pa͖ <`#@B <;a !x 3!!Ȁ *Ȁ  ̀ !"D #`?"``@* "@@ #"Ԓ :Ȗ B?!@c"DR a@L #@ M` !x C`!`!<`  8`"! :` !2 "D?`"@  #* "@ #"D?`" * " @ @ "D` " @iĐ"̐??:@H@i"08H@i"04#P#P @ @1  ` @[D? "   @  H@i"XT" 􀢠"`@q` Ԑ 'l` #@3 !!Ȁ 49Ȁ  ̀ 0"D #`?"``@* "@@ #@"D"͒ :#@ B?Ȁ   !x aB@Z:a` ؀ `  @< `?"``@* "@@ݐ `` `? "`` ,`:  @* "@@`B :@Zn` Ԁ  !"Db@]"D@'#(#@ B !x :!!Ȁ Ȁ ̀ "D?`"@  #* "@u #"D?`" * " @e @"D @  " @h"̐??: @H@h"@9 XT"` "@@  @   @  @p !`!܀ `  @  u!@oL@ʒ ?j'\@7 '`\`H@Fg'd?_"D!H#X@\@@졔0PXT"` "@  @ "܀  ?"l@ @ 03@e#cD ?`"!l@ $cD쀢   @ "@!`!  @{ @~ @{ use of scoped address can be troublesomesetsockopt (ignored)EPSVwrong server: return code must be 229 disabling epsv4 for this connection PASVLPSVPassive mode refused. Passive mode AF mismatch. Shouldn't happen! wrong server: return code must be 227 %u,%u,%u,%u,%u,%uPassive mode address scan failure. Shouldn't happen! wrong server: return code must be 228 %u,%u,%u,%u,%u,%u,%u,%u,%u%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u%c%c%c%d%cparse error! setsockopt (reuse address)bindlistenEPRT |%d|%s|%d|PORT %d,%d,%d,%d,%d,%dLPRT %d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d㾸Ô  't` '` ? ?@?@@g:"Ha &à(Ò @  @] "#D@f#- @cD?"D $!p!  ?c t@  @f֐"xÐb(   7 S! ,#a '"al@    "D @"#8 `$a"D@"!""͐al@    "D @ϐ""!!p  @{D? D"!d$!p"D@"!`b@Ͼ DÐb(  2!l @   "D@#@v!#\#`!ch@2њĀ à(  @7*`* @*ÖǕ*@  (( @ 4 , )$ b@v !l @v 2 À "D@Q#4!ô"(  ? !ÔĘh#\#`#d#h#l!cpl@2~ Pp ^l Zh VÒ  @ڐ * *` *Ö Ǖ* *b( 6.&ĘȚ̄ІԞؠܢh#\#`#d#h#l#p#t;x;;;;!`pl@20 "D@ݐ#!p  l h "D@ː#!  @˦ϗ*ۅ(ߕ*+ *  Ó*`ӡ, @+`@(+(@+ @ǐ ((, @$ @6.&$Q$b@Ξ m!!l'@   "D@x"[!#\!`@@1 OO@ O@O@"D@X P;!à"(Ē`H@ 4  "  !!p @d#$!!cD "(@"( "(  " D 't'à(Òb@v )# 24 #cD?" @  @,   $cD@dĐ#` %# # cD ?c t@s  cD@d `!(@P ( @d !! cD?c t@V   @d"x 'd(cD@9d cD@d#!@y  6# @dy # ` ``  6! /! , (     (x #\ . @ɚ    #8€` "!"D@" Aà"(    9    #\*    #\#`#d #h #l#p #t #x #| # ## # # ##1 # ? %# '`&@ ` %#    'tcD  t@   @cԐ# !@#D`?$#D͐ "c  acceptp "a ''#D#cD@Ԡ  !@c"xcD@ ?$cD@cDـ $cD 'А  @Y  6cD@c#cD@"㿘!# b`!2 $b  ($b@ $b㿘@{ cH "cH㿘'!c$H@     "#  !c""H%&@""H  @q!`. `!Ġ H$ @א! a @Ӕ !à" @͐!a @ɐ<&!<a<T"<&!@a@!"T&!DaD#!&!HaH"&!LaL"L"&!PaPb#"L&!TaT#b&!XaX!L"&!\a\!("L @%!`@a`!͠#$ @!qaq@ߐ`8!&!a!"`8$@!@ђa!Ƞ!$@%e@Ȑ @|H $H 㿘@̐ !"D?`" * " @ @"DTɒ`"T#!"H"x@w STOUproxy server does not support third party transfers. No primary connection. PORT %slocal: %s remote: %s aborth"'D''H'L'@ޒ ' "耢 """'!  1!  !Ѐ 2 1!" "耢 "D"@"0 ݐ "H  !"D"@# ѐ ?"alԒ "ː#8ja @"x < "b\@ΐ c'DWL @  0@ސ  `'CH  !#L `$#L ￐ @  ""D$#LHc@@oL0@ "#LD@Gb  " p !D@8b  !" "` !"܀ 2! 2 !#H &0"܀ "@ "C`?"܀ 2#! 2!#H "!1 "܀ @ ) "T ?"al@6 0J"܀ "@ "`?"܀ )Ȓ  @#< R 2* + @ $  6"@ad#X"T ?"al@~  "  ߐ "T ?"al@ resetxؐ @A #< R 2*@ + @ $@  B$  `@a%?@D"al   ́runique: can't find unique file name. 㿘@M / ` 1,@@`""@r ` /,@+@`"; "D $@.!003`@ΐ@* .*&`  d,,@: ` 9,@ 0`@A ,:  02 L .  1,`,"ߨ 1 Lost control connection for abort.%cABOR x!#T $@`Ɛ""T ?"al@`0   @#TR  @ܖ  "#T"@`z#X#T$c@ @#Tؒ  @u#< R  2`* `*   $ V 2 * *@$ l 4 6"@`N#X"T ?"al@h V 2 *` :@` V @a$ 4V  !l"(  ftphttpFTPSERVERPORTftpgateFTPMODEpassiveactivegateautounknown FTPMODE: %s. Using defaultsgate-ftpFTPSERVERNeither $FTPSERVER nor $GATE_SERVER is defined; disabling gate-ftpTERMdumbemacssuAadegimno:pP:r:tvV--r requires numeric argumentRetrying... 㻀'D'H@O %%a%"#"@3!̀  "b%! "bа ͐$3#%"b#cX p <""# &a$ap@$"bP%"a "@ !( ")P%@a0 2%&a$apa8@ 2%&a$apa@@ې 2%$aH@Ӑ %$ap&a!P@_P <%@Œax 2%ɐ "a%@Ԑ!ɀ "aJ !%!"a!!  %!J 2%%@_t!$!%@!蠒  %@șa %a@ȓ %@ȍb 2 !@T Ā "`h "a XR@"bD j`h@ $ cȐ `"``5['!*` "!pS"aɐ O"a8 `"F"8C"#X@" pȐ?<"`9" < "%b @? 0!,"bD’ "!&"p "!"" "#\    @X!$!%b(@ Ð  "b "a"!@\H%D@Ԕ#D*`" 'DHÒ@ ͢ "# 'H#""@k"x @V @^@W @q"H@h 6a(@" D $JH  H"Dx &;@@! '@Ӑ a@ 'b @ P <H'@H'`H'`''D@t 1!耢 !"H  "D%"D@"H@!"H "!@!`?  'a@̐ 'b @Ȑ @  t < $ P 㿘@ !@嬒 㿘' @ސ #bH !#T " !R @= @#T$#T!#D & $bH@= @ #D?$#D$bHN bH  !#T " $bHR @=z @#T$#T$bH"!; $⨁ftp> '"sorry, input line too long. ?Ambiguous command. ?Invalid command. Not connected. 㿘 "D?`" * " @@ {L dƀ`"', "D'@#!`? "`@! !  &!` v!s'@#a P1"P@r? "D'@#(B2 L "D'@~#@9Ā  "H  "P"D'@p#X+"P"cH €a#P " L  "D `?"``@* "@@̐  )",@' h " Q!@="D@ +"D̠"1$@0!    @0 n'a@ 'b @~  - D   `"DJ@ KJJ@J`J2  "  " `2J@?㿘%Ð"a P""d#!#`#$a $a@P@ a!$aJ@ `d!$ ᔀ J@ `"#aJ@!((fxd" \J@ "` ?`ᔀ  J@ "" \J@ ' @"" 0 \2 *` `J@ @ *` J@ @"2*ݒ``  " `d* `d #a!    "!"! \ %sommands may be abbreviated. Commands are: Proxy cC?Ambiguous help command %s ?Invalid help command %s %-*s %s 㿘 U?@)%â"D)`!)!)!ؐ @? 3b1!D* `  L b@b!D*   *@ @( 0!@Ȑ? )"Da )"Db@ ?)"Db   @? `usage: %s [-adegimnptvV] [-r ] [host [port]] %s host:path[/] %s ftp://host[:port]/path[/] %s http://host[:port]/file 㿘P <)   c@Ȑ!@ macdefmachineaccountpasswdpasswordlogindefaultHOME%s/.netrc%s/.netrc: %sr%sanonymousError: .netrc file is readable by others.Remove password or make file unreadable by others.Remove account or make file unreadable by others.Missing macdef name argument. Limit of 16 macros have already been defined. Macro definition missing null line terminator. 4K macro buffer exceeded. Unknown .netrc keyword %s8*@@   @ # !* @! ?@Z *`@ِ*`@  "` " * @Z @! &/@/ . \*Z  0T F@{ L'ࠐ@0 :#a@* 4a@  . "@  a@4$ a$L @ . #@  $ࠐ@ L@ 0"'@   *D `*@, @  ! @x@ @&@0@`؀ *@x`耢   @oR   ?*@  ! @N@ @&0 @QR   ?*@  ! @0@ѐ @&0" )@Kx  ") ")  '"D*@ !D`%Ñ*` *  *    ``@KO  #\   ",  ,@K<  sDĒ`  p"@ *` * ?`"-$D*` * @ * * `"D%Ó* @ *` #@K EÑ*:  ,L? D, `pȐ p "D*@"7"8@Yq`@7    @,   @Y] *@YZ!` @4 0"D*@j!"D*@c!@YC *@Y@!( @?㿘!  T @J   ` `,3#`"`02.@J . @J `"`\.,`2.@J~ . @Jy  ` ` ` `,퀢`\.L`   H`  H@` "    stringlist: %m㿘@ 2 ,b@Xr & & @ P &,b@Xg 㿘  @2 *@&  &,b@XR  * "  & 㿘  `  @ .` @}` @*@w@u㿘  : , @ 2  * Already connected to %s, use close first. tousage: %s host-name [port] gateserver not defined (shouldn't happen)PASSERVE %sConnected via pass-through server %s non-printstreamfile8binarySYSTRemote system type is %s. 215 UNIX Type: L8Using %s mode to transfer files. 215 TOPS20Remember to set tenex mode when transferring binary files from this machine. 㿘#bH'H  'D"D-` D-D@HD  H"D-`@0?"al!! ""H ! H!"-J -`@  E  A  ! H-`丐! ! -"Da@ -a@ $bH@"X"h-aP @""-aX @ -!` ` !`*+ Ȑ "|)-ah  @" <"!"aH  @ #8'€ ጐ?$-h!p #!€`!-%°ܐ@  @  L? ."? ,"D-ax@ێ܀ 2,!-a!@  "  "a "a` -"Da@p"$" "!"!`-!ؒa@” 2$"D-@%!$ጁanonymous%s@ftpName (%s:%s): Name (%s): USER %sPassword:PASS %sAccount:ACCT %sLogin failed.init$init'L`'H  '|HLؖ| H?"al԰ H L - ! ' !!@ !@@\  'H@V@O 2."0'H!@d.H@@! ."0'L'H 2."H/'H@:  @V@O 2 ."DbP@͖ ."Db`@Ŕ/ O@@?.@O 2'H'HH .Hh"p`L 2..@ܸ"x'L.LY"``| `.@ܨ"'|.|I"`.`|`.<" .@V/" 25 ! \  "  0'.b @"G "P!@05DÐ? @ "bH Òb."@0 D`@  sorry, arguments too long. (%s) 㿘̢"@$ "D/@"p"D/@$b ,@ $"@@ @ ?L@ ",@  !@$ $"P&@TMPDIR/tmp/unable to create temporary file: %sftpXXXXXXXXXXunable to create temporary file %swNLSTarcan't find list of remote files, oops. can't find list of remote files, oops.㻘! #X !?"! Ā  @B$ #X + ""`"` ""0`Ā 2/@ # /#@`J? /  $d !/#@d ?@U+ @?L /" /, /cȔ @ ;@猐 /#@Tߒj @1€!?&!&!'@`$@"[`?`@0` @0  > `@0` !l@ d !&`"5`?0`&!$@@%`@0`Ā 2 0"D0@ڐ   H&!! Đ@˒$  @Ѝ $ @ 2.%s %s? Interactive mode: off. Prompting off for duration of %s. n, y, p, a, are the only acceptable commands! 㻘%p B#cH 2? !0"Dc@@}"D@$ , `H*  R  n"$  p a1"D y1"D0"D$p@i#  0$cH"Dc@ؒ @؎`!ð %s: not foundh#X ! Ȓ  ,@ @, @ 2@Ȁ  @1@T!`@  @$@@SIZE %s㿐#%c8 ???$1"  !@_ $  @$i J  #\@  2$??"$c8 2 $!"D@!"D@ d $MDTM %s191Y2K warning! Fixed incorrect time-val received from server. %*s %04d%02d%02d%02d%02d%02dCan't convert %s to a time. H#'-c8ጀ l?$1# a`1\!!   " \   2 1c(@-  2"D1@’c0  2 0, ,, #\#`!1Ėcp@ɐȒ  ,@ 3?'''Ę?x''''@?쀦`c8  1"Dc@׈$"$c8 2 $!"D@F!"D@ $ጀ?"%l㿐! Ȁ?@0$ `w @ m?   `?㿘# b  ?2$b@ $b %3d%% |%.*s%*s|************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************* %5lld %c%c %2d: %02d:%02d --:-- ETA - stalled -%02d:%02d ETAh!¢!  @栐`! #P " # :@擒  +ax ax15!P@ B `5- -@B2`* @ *`B2*@ *@ȯax  d & d4 d2h"@槖 @?․`@ @X d@ =@ :3`""@22#\p"@抚$@  4`  <    4  a"@ , @ @ `J@""@3`  #\ B#\@^   "@'" 'А"@''!!` " " ;!    " @ # '! ! " `'" `'А"@@'' ؀` 腠DA?؅B.'@Ɛ @ @ ""@3 @.@ @ ""@3@(.@@ @ "$@!3 0 <@ <@{@Ԗ%! !`   axax`(@ X@ U""@3@嬔@^%À ax@ H@ E""@3@圔PN%P @b !!@?ؒ. ЅąB'@A @ $@ !""@3 @w.@ @ ""@3@j(.@@ @ "$@!3 ` <@ <@@O%DR @ @͒ `2b$@: @ 0@ D?`" * " @~H @D%lld byte%s %s in %.2f seconds (%.2f %sB/s) sMK ETA: %02d:%02d:%02d !  @乒 ! ! " `'" `'А"@@'' !! 腠D@I?xx B3? ?  @ǻ  4(4 4!#!` !  43 4# tx#\@;``  B`;h4#4##p@䘒 d V! !Q ` M x Ex`Ax#P!@ D 4: x3x@ @֐b !@?px. pąB'@.@@@ d$@!4# <@ <@@B  "DR @ܐ@㿘  @ ,`@@4 `@* ?`@@Ւ "  @ ? @I 6C`@,` "D@}  "D `?"`@* ("@@} %`@-`"D   ?`"@ * "@| 逤Ħ`@ 㿐"D# bR `h@?   P" @Đ P"`@$b㿈'''' @9 㿘@k/etc/dhclient.conf/var/db/dhclient.leases/var/run/dhclient.pid-pbinding to user-specified port %d-d-D-cf-pf-lf-q-u-1specified_interfaceInsufficient memory to %s %srecord interface%s %s2.0pl5-OpenBSDdhcpcudpcan't open and lock %s: %mNBINo broadcast interfaces found - exiting.PREINITalias_㿐@  @@: / @ @ @   ` 6@@ʒb( `@K@@! * 64"0@8ٓ2`6@@bX 6  }"b@@b` 6  s"bT@@bh  6`@@c"!@@bp  6`@@S"!@@~bx  6`@@C"!@@nb 6  9""<@@db 60"!P@@[b 2@ &"aLJ -6@ؐb@ ` 2  66@"@7ҒbВ  `@@ @   $$ L"!"``` 66"a@8! "! ! "  "66#@rc 2  D4""' ! ?4"H@l"H X?"  *X * 2  #",@\ @|#a" @ 6a@7#@ % @ @ 6c0 @  @  6@7Ґ#8@ #a 6 L  26 @ sch P 6cp@ ѐ@  2#a` @    @`@  @l@'#@ " g P "`@N 2 Pg  @"` %sUsage: %s [-c1u] [-p ] [-lf lease-file] [-pf pidfile] [interface]㿘!8 a@7haX@7da@7`#8`@7\a@7Xb(@7T@7R8 @7$8@6!㿘 P@  02  @!0@("` P"`, P@{@ P a$@q  "l P" 4 P @ "8 P@a"`<㿘 P@@ PD ", Pa$@S  P "` "l P" 4 P @ @"8ARPCHECKcheck_㿘8#@=!H@ P  ! ` ,8b@ 8c@ @  $@@@@ ې値` P`"  P "`0@a܀ ! P " bl  P""` P c@   " P   @ @ "  P@"`0 a$@ސ  P "` "l P" 4 P&  @# 8 PD@ ",@ŐDHCPACK from %spacket_to_lease failed.㿀 (P ,@ @ށ P     !9   @@7@6J@ 2P9@6B 0r>"`#@?P aЀ "@:pP`!"`P ` 6P#"`P  "@:ZP`"`2  : "P  "@:JP` "` 2`@ : @:@" P  l` "`P ` 6P#"`P l` "`P ` 6P#"`P l`  "` P ` #"` @REBOOTREBINDRENEWBOUNDold_new_bound to %s -- renewal in %d seconds.㿀 P`< `"`, P@ {` P   299 ##9#9# ,@ I P 9  9c@  P9 c@  P 6cp@ @  P " P@ P:a" P"  P@  P!9` #@@6 P @`l" @5T P @X"`@ j㿘 P@@ P`D"`, Pa䀤 2 a @  P"  a$@y  "l Pb" 4 P   "8 P@h"`  BOOTREPLY from %s rejected.h * (`P",f @   @IȦ @C@6}   @:@6:@4"p0@DHCPOFFERDHCPNACKDHCPACK%s from %s rejected due to bogus yiaddr of 0.0.0.0.%s from %s rejected.` 9;0Q<0N:! cP:#c`:!cp"'Ē`@”  2 (#:  cx@@62  #@א@6(@40  (`P",f @  @ÐȦ @@5 2!:BOOTREPLY%s from %s%s isn't satisfactory.%s already seen.ARPSEND㿀!܀  (:#P;!@P` `,@ @S !;  !P@s@5Đ@4'P&  &  4 * @ w 2& P    2  `@"  g; 2 @ 2!9@3 0e 2P 0 $ 0P; <a $ ,@8c@@ P b@?  4@  @  P $P" P   "l4 $P` 2"`@ 2@"@ "l$@ &@`80;!`@30 !x@3Ē0 c@F=!H@dhcpoffer: no memory to record lease. dhcpoffer: no memory for option %d Invalid lease option - ignoring offerdhcpoffer: no memory for server name.Bogus server name %sdhcpoffer: no memory for filename.㿘@(4 <@3# {  @(4 , 4@ "@ې  8W$ 8 @{@@ 4"*@ @  L, & ` @f !Ԁ "! 2!J , "!@ A & $<.!  @@L`, $* @@  $ 2! $<@2ѐ!H0 "! "J l @ & (< !`<@2 0< @2@  @`l (* DHCPNAK from %sDHCPNAK with no active lease. 㿀 (P ,@9 4@ѐ /P     $!<  #@@46@2P <@2#0@P>"@#@P "`kNo valid media types for %s!Trying medium "%s" %dMEDIUMDHCPDISCOVER on %s to %s port %d interval %ld㿈 P' 4lb "@  @ߐ0 6 b 1   P`< " P "`< P < 2 P`" P= @1Ӓ  P "@ "< P=`<`@2*  P= <a@֐@L 2 P * P8  b  "8@" P: `8@, $`8 P"f `8@$ P@" P: f @2`@@<  $`88 2 P b "8 P "@l84@ "@  "8?#  P2 H2 H P# `HbX2`0`'!=!@v P`8`@1   P ",'@#\@" P=laH 8@^No DHCPOFFERS received.Trying recorded lease %sTIMEOUTbound: renewal in %d seconds.bound: immediate renewal.No working leases in persistent database - sleeping. FAIL㿀 P>@@1t 8 P` 2Z P`s P' l I!>  P@@2@1U P>`p ,@ P9c@` P 6cp@X@h 2% P Pl   " P>@ x`@1+"@  P:a @Ք0>"@1 Ӑ@#@58 P` "%@ P @ 2@ "@" P` "@ P` "`  P" 2 P!L >@ "`  P"@0 > @` P 6cp@@ P "` Pf " @ l8bt @~@EXPIREDHCPREQUEST on %s to %s port %dx P! "l4"@2 b $  P "`>#@0J 2 P< 2 P ,=a@F@ 2 P P`," < P 1"l @,>c@/  P9c@ P 6cp@@6 @ch P 6cp@w@ P "`?08  b  "8@! P: `8@>, $`8 P"f `8@$ P@! P: f @4  `8@(< $`8 P`   "l@ `8 "  "`8 P   "l @$?'  P "H 7//    2?0#42H2H2H'!>#@u  @/쀢?" P "   P' @#\@!   P'@#\ @!   P>"lc8@uDHCPDECLINE on %s to %s port %d㿈# bX`'!? #@tʐ`@/  P",'@#\@ ޒ DHCPRELEASE on %s to %s port %d㿈# bX`'!@  p@t`@/  P",'@#\@  ??c  /  @ $@ P %@ @ Ԑ$@ $@  " @ ?" @  " @ "  P($@ &  $(&  `@ "  P&  @ " @ " @ "  P` @x% Ȑ$@ `$@ `"`@ `" @ " @ "  P"%   @ 2" P( , ? @#@ ?, "@ , @"  P& , @" @" @" ښ` P`@#\#`#d   @"  P"e Pe!+ !,"e P *`@ P *`A P *`B P@؋* C P"`D P@ 2`H " P P2 J 2`J P " L P" P P" T P" X P @ \?c  /  $@] P %@X @? Ԑ$@ $@  " @ ?" @  " @ "  P($@ &  $(&  @ "  P&  @ " @ " @ "  P  2 Pa ؐ$@ $!`4@  "`@  " @ " @ "  P ``2"%` @% Ȑ$@ `$@ `"``@ "`@ " @ "    @ 2" P( , ? @#@ ?, "@ , @"  P& , @" @" @" ښ` P`@#\#`#d   @!ך  P"e Pe!+ !,"e P *`@ P *`A P *`B P* C P`,"`D P2 H P`? `L`@=`  P"`L@ϐ " P P2 J 2`J P " P P" T P" X P @% \  / $@ P %@ @ Ԑ$ '  "  ?"   "  " a!$ '`4@   # @ ` "  "  " $ ' `"`` "  "  "  Pf -耢  $ f -'f - "  P& - "  "  "  P`@#\#`#d   @!<  P"e Pe!+4 P!,"e P * @ P *A P *B P* C P,"D P2 H P2 J P" L P" P P" T P" X P @ \P /ǒ $@ P %@ @ Ԑ$ '  "  ?"   "  !" a$'Ȳ`4@  # @   "` "` "` P#\`@#`@ #d P"e Pe!+4 P!,"e P* @ P *`A P *`B P@* C P "D P2 H P2 J P" L P" P P" T P" X P @< \㿘 $ " (@ (  @,  4  8@   , @wcan't create %s: %m㿘%  !@B!@{sc $B!@,W# "` `P " @{  `P`@p @`2`P "``P " @^  `P`@S @`2`P@flease { bootp; interface "%s"; fixed-address %s; filename "%s"; server-name "%s"; medium "%s"; option %s %s; renew %d %d/%d/%d %02d:%02d:%02d; rebind %d %d/%d/%d %02d:%02d:%02d; expire %d %d/%d/%d %02d:%02d:%02d; } p2 `0!#` `$#`[$#``0 5  2C!B!@zʒc &B!@+#C@7``02  "CC@.`C @)a!C` ! @?@-@`(C@a8`$C@ aP`,   C@ah ,`4 #x, `8  @!! Cax@,@1`!  Cal #\#`!@#d@` C al #\#`!@#d@ `Cal  #\#`!@ů#dC!@ūb@g!script_init: no memory for environment initializationPATH=/usr/bin:/usr/sbin:/bin:/sbinscript_init:n no memory for environment initializationinterfacemediumreason㿘 : d P"f P&@*  P"f P& 2DD@*א D@А!  Pf"@ P& 2 PD@*Ȑ!H P8&`" D P@ D P@D P@ip_addressnetwork_numberbroadcast_addressfilenameserver_nameno space to %s %sprepend optionappend option%dexpiry P!D "@&@,w@c< M @@<8' @  @ h#@@+h 3!D P "@@,K@7 2#( @ @P#@@+P #D P b@֐@,'@(D P@ $D P@   P&  V 4M-  "  P O  $0M& `H@  - #x DD"@*%c P @ P8& @  #x-  DD"@* c P8@r P& @@i,  4 8 x-   @!   P @X @  `D( @HD P0@vREASON=NBIfork: %mwait: %mexecve (%s, ...): %mhEc8@  P& b   & #Ȓb  h''''@' E#H@ʐ̀   E#X@)A '̔@E#h@)8@ "@z Pρscript_set_env: no memory for variablescript_set_env: no memory for variable assignment%s%s=%s㿘@m f,  @ 2fJ =2f@ "f@D 2  @0$f $fF@( f" @@@=@:@ڐ f,"@f 2fF@(ΐ f@(@@%@"F`@v㿘& "&& &@&"&  2&&& "* 2 H-2* _* H* Can't fork daemon: %m㿘 " @.p  "@ "a F@(l#00@ @ @z @x @v @Can't create %s: %mCan't fdopen %s: %m%ld 㿘!!&@”! BF!@({#0@ޒc 2!GF!@(q#0 @ڠ @¼@LInvalid IP address in option: %sBogus Host Name option %d: %s (%s)unknown dhcp option value 0x%x㿘 4.` 8@ @ @@`"G!.` @P  G @() @  G Ȓ@(   G @(!P  p  p p p p p p p p p     p            p             p p  p p   p      p                                                                                                                                                                                                         J .( J.  .`.`Ѐ   Ѐ -2 `2J 㿐   N .А ( N   N " @q "N option_as_string: bad code %d \%03odhcp option too large㿘1͢#h% `H@&h#87L  #\ @J  `" @@H" @X` `'`$```\2 ,@ \,@ `,@`` @*L4,@H@&e#`1H#x#hrno memory for client state.no memory for client config.㿐5@ y7 @3!"0 @"@ " <$@" $@" "!"!,""$$@"" $@$@ $@ $@ $@@ * $@  * $@  * $@ *$@ *$@  * $@  * I$@ @t` @!? @@ ܒ@ؐ " .  P 2& @& $ PI@%  P @&  P& 2`2 P%@0  I@%  cȔ0@9 P"&  2 P "`?Corrupt lease file - possible data loss!㿐!@!!I@t` @ ? !I@’ @%#H@3hardware address parameter %snot allowed here.nested interface declaration.expecting a statement.semicolon expected.㿐@ T>`I*`J# @,0@(  * "@@  *  ~"@ x *  s"@ m *  h"b @ 0``@3̒`0ZIJ#@%Ӓ`@20R!!@  "K&! @!@0@b b  bbbb @30+@2ːb && `J@% @G0@ 0@  0@0J@% @@2^@ ;J@% X@2T )| * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * ( * ) ) ) * * *P *h * * * * * * * * ( )` * * * * *, *8 * * * ( ) )4 * * *expecting hexadecimal constant.hexadecimal constant too long.string constant too long.expecting string or hexadecimal data㿐@i~   @:> .@ @4~ ) @R`:@%`: 'aK@@T K  h@0  K (K H@$̰ @1expected option name.%s: expected option name.%s: too many options.expecting semicolon.㿐 @ݒ !!? K&!؀  #x,  @pk 2 !K.@ ! @ ,"ۤ ; K0!K@$x"0"(@$t@1G expecting interface name (in quotes).expecting left brace.unterminated interface declaration.㿐@!K!#8@F P 2& @w P& 2 L@ L ?$ L "a@i { K#`@$+@00K@$%#x0@? } Pf @KInsufficient memory to record interface %s㿘 "  @ 2   "  @v 2 @ `  L @"  `@  @+  b$"bno memory for state on %s 㿘@& & PL!@"ڒ  P @& no memory for config for %s 㿘!@Ȑ"0 P"f  P& 2 PL"@"  P"0&  @̔ P& @\no memory for lease. unterminated lease declaration.㿐@ {K@##`@0T0@(4 2 L@"" @(4 0 * .`@$ 0'@ƒ?a }@u@`2`Pސ0^ ` ` PT"   P `  2 @Ӓ  2`  P"` ``P $`P/"  P& "l 6  @ʦ    PL@#"0  P " P@"`  P"expecting lease declaration.㿐@>`:@*`M" `0 ;&`0@!K@"Ґ#8@/0+&`@0 /0$`,@ 0(@/%&`(@/ܐ!&`$@36&`@32&` @3.&`@’`40M@"! @/v@Ւ ;K@""(@/l 5 5 6L 6\ 6\ 6\ 6\ 6\ 6\ 6\ 6\ 6\ 6\ 6\ 6\ 6\ 6\ 6\ 6\ 6\ 6\ 6\ 6\ 6\ 6\ 6\ 6\ 6 6\ 6\ 6\ 6\ 6\ 6\ 6\ 6\ 6\ 6\ 6\ 6\ 6\ 6\ 6\ 6\ 6\ 6\ 6\ 5 6 6, 6< 6\ 6\ 5x 6\ 6\ 6\ 6\ 5expecting identifier after option keyword.no memory for vendor information.expecting identifier after '.'no vendor named %s.no option named %sno option named %s for vendor %sexpecting string.option data buffer %soverflowexpecting number.expecting identifier.trueonfalseoffexpecting boolean.Bad format %c in parse_option_param.out of memory allocating option data.pԐ@   !!? M@!Ӑ# ;"J @.F @>@ߐ  M@ ؐ#@3 @ @ .' @@ !!?2  M@!#耤 ;" @.r "x@ 2  N "@'  @Ԥ  Ԁ@2NN ؒ 8@!}0@츐* : `2O"ܓ*` $@"Y@!N@Ԕ  $Ԑ;@ @/؀ ؒܠ $@;{@v!" N@!8 ;" @. Ԕ @0  @]!NԔ @0 є @M!NԔ @0  @= !!? NN@  ;"p @-ɐl @lȒ`Ѐ N@l’`؀ N /@l` N@l`耢 N/@ Ӑ ۀ ; L@N@ !0"`L@` @`AK?@L@`A ," ;J@  X0 @  `0NN` x@ @-{ @븐 *`@ "` * @  2 N@!0 * @ @M * &@ < = = = = = = ; = = ; = = = = = = 㿘 "` 1  1@#]@ $1@ැ@ഐ :,`"@ ,? #1#]c@  Lease %s%Y/%m/%d %H:%M:%S start %s end %s stamp %s hardware addr = %s host %s `!^   H@ߺ@ @@oߐ (#^ؖ`X @g(^@ p@oѐ , @g^@ @oƐ 0 @g^@u  u!^ t vs @l h^` `^ @a packet length %dop = %d htype = %d hlen = %d hops = %dxid = %x secs = %d flags = %xciaddr = %syiaddr = %ssiaddr = %sgiaddr = %schaddr = %02.2x:%02.2x:%02.2x:%02.2x:%02.2x:%02.2xfilename = %sserver_name = %s %s = %s㿈^ @" `^ @"( `@ ``^` "X@`` '!^"x@U@`!^'"@U@`!^'"@Uܐ@`!^'"@UӐ@ߐ `^ `" ` ` `! `@#\^`l@ѐ"^#@͒`, ^ ,` 8 #x,`  4   @ ^#@``,`^@#(%03x: %02xH  P */ _@m_@$@  *@ _@$@ڠ@Khash bucket %d:㿘 % !,  _!@4 " ` @&  2 ,/dev/bpf%dNo bpf devices.%s%s%s Please read the README section for your operating system.Can't find free bpf: %mCan't attach interface %s to bpf device %s: %m` _ 2@2 @  " ` _____"b@a_@^#` Hbl@ _# @PSending on BPF/%s/%s%s%s/㿘 "< 0 & 4`    Ǡ  ` 8` @` @@ Can't get BPF version: %mKernel BPF version out of range - recompile dhcpd!Can't set immediate mode on bpf device: %mCan't get bpf buffer length: %mCan't allocate %d bytes for bpf input buffer.Can't install packet filter program: %mListening on BPF/%s/%s%s%s㿀 'T& 0bq@f 6`@ǐ  ` 2 0`@  0 bp@P䀢 6 0`@!( 0bf@E `@!X @ڣ& < & 8`@!x "& @& D#"D 0 ''bg@%耢 6 `@! "< `!     ` 8` @` @@͔ fallbacksend_packet: %mx`\c'@Ð  '#\@@``#\@~#`' 4 '''@ݔ谒 `@e#ȁ㿀  @ D@2  D 0 8@W < W$ @$ D D @"@  8@ @ܸ  @ D <$ @*`2 $ @37 $ @ 8@ 6 @ @%   8" $ @  '@  @  $ @"  ' 8@z@  @$ @ $ @ " @   㿘  @ "s`4#?attempted to reinitialize icmp protocolicmpunable to create icmp socket: %mUnable to disable SO_DONTROUTE on ICMP socket: %m㿐#cЀ  a@ "a"$c@U 2  @| !퀢 $#a@ l"#?c' @|3  ba@ ^"b#Ԑ<attempt to use ICMP protocol before initialization.icmp_echorequest %s: %m`#Ѐ 2 a@ 8#    ///'77/77Β  @C@^7#Ԓ  @b  6  !b'Ġ 0@RĒ@ J `?icmp_echoreply: %mp  'Ԓ%ܖ @:ޚԀ  /b@ .!(0?쀢`'  '' @ۋԐcSc㿘  4@(b a@N  " &  `@d !؀  `l@T ! `,@K @option %s (%d) %s.larger than bufferMany bogus options seen in offers.Taking this offer in spite of bogusoptions - hope for the best!rejecting bogus offer.parse_option_bufferCan't allocate storage for option %s.Can't expand storage for option %s.㿘@u@`o`@'@`@ ',!##x, $#bb"@ {## b & b$#@ o"b@ l#b@ i#00M@ f#PJ&  8  4bchX  #x, b@ #@ڽ. 4#"@bch ? 2 #x, b@ #@ڤ@@@ڟ@$@.:%@@ ` @ ` & ``d "` ! @} * 2 \ !* @8Ȑ 5*@  6*@   3*@   8 *@ !` `! !,8!(@O `  !,8!(@C  ! tcx@; t ?"Т@ y 2`@Ȁ#\#\#`@eb! &`@` T` *@  N`z 4 * * **?"А`@@  ' @`l@@ . . $. @`l@ڔ ?bА@' @͐`,?`l *@ * ?`l㻘\'H'P @ $ i P ,`"_` 2[` %@( S`` #x , J t ` A  `<`    '@ 4% H ޖ-* ,@@^@@* ,@@T@  @@Ȧ`@Ppretty_print_option: bad code %d %s: Excess information in format string: %s %s: garbage in format string: %s %s: expecting at least %d bytes; got %d%s: %d extra bytes%s: %d extra bytes at end of array \%03o%ld%d%xtruefalseUnexpected format code %cdhcp option too largep; ? c' d"@ 9  ,cx .    a@jx .   @+ @?* : `3=f#*` +;  @N@ @ @ N@ @ \J  2`@ x t+?+` : @*?ِ t+`+?` ` `x` @ d#0@ cx .  `J @#x.  d#X@ 1dcx` @ d@ #쀥@@ #x.  &d@ #@ @x#x.  !d#@l&@ Ȓ&  @cت @ʐ` ?* : `6*`f"  5 "- 1  #\ @J  `"@@d"@Ȩ  `'`$```\2 - \-  -  @*L "i- "- c-@ ѐ'@NԒ@c!d#@ ̐!d#@ @Ӓk$D!d#@ ː* : !d#@ * 2 @U$.Ldؐ@ dؐ@ d@ d#d#@,$0dJ@ #@-@*$`@  : -  @<ؐ`- @+ ce@ 1d# x  X x Discarding packet with invalid hlen.do_packet`` g@ h06 (8@5'''В@Ô '?'̀  " 'Ȁ Ӧ S ,    " g@`  , consno memory for cons.㿘ga  2&g@ڐ!&& tree_cache㿘gM! " " "" " " tree_host_lookupNo memory for host lookup tree node.㿘g"@ 2 g@"X &@& enter_dns_hostCan't allocate space for new host.㿘g"Ȑ ƒ " g@辐  $g@"@j}$ $ $ $ tree_constNo memory for constant data tree node.㿘g#pȐ 薐 & g@X# & @& tree_concatNo memory to concatenate constants.No memory for data tree concatenation node.㿘 `?2@; ,h@ 2(h`h``V 2`h@ `@տ```@պ``Y`V$``` F$`b  2 h@ H && & tree_limit㿘 h 4$  E!  && &  tree_evaluate㿈 ' ''0 @3$ 쀢h$   !  '  '@' " $$ $ Bad node id in tree: %d.㿘 "  h0/ !h0*!@A@1̐&@"1#%s: host unknown.%s: temporary name server failure%s: name server failed%s: no A record associated with addressdo_host_lookup㿘) "l@t@ 2* " "i   i"l i"l@@ "l@; ( "li@5 P"l@0 h"lJ < @ "  `,`@ 2` @׿ @i  2   "l <(& "&&&   @ן,`@ @h` @.@"ln&&@㿘" $@@E &㿘   5 7   3 8 9 &(&&bh " "b8*8*'"㿘 ? & @J  & ` 2)"``  8 #@   8 "bh"8   8 "# * Q  b8*?b8*@ " 㿘4:  #\     -   ""4"b0@0F#\      ""4"b0@06    ""4"b0"*ؐ++        "$  #  ##\     # "@\ 2.   ""4"b0@m㿘 `   "4  "8 ""   #"4 ""0  #` b8 "b   $㿘)   % 4' 0# $`! $ k4% `  "h "" 0$4 $`$0$   & 㿘? eof in string constantstring constant larger than internal buffer㿘   * %%`j@O#(%  * `\`"  %2 j@:#@%   "`*!numeric token larger than internal buffer㿘# ,`   x  #\   D  `@B   "``* %%2 k@ 0%   "`*!token larger than internal buffer㿘! , ! z-_#\    @   "`#\   D "!  * %%2 k@!8%  * "`@lways-reply-rfc1048ppendllowliasbandoneduthoritativeackoff-cutoffootpootingoot-unknown-clientslassiaddrlient-identifierlient-hostnameomainenyefault-lease-timeynamic-bootp-lease-cutoff-lease-lengththernetndsxpireilenameixed-addressddiroupet-lease-hostnamesostardwareostnamenitial-intervalnterfaceeaseax-lease-timeediaumameserveretmaskext-serverotptionne-lease-per-clientrependacketangeequestequireetryenewebindebootejectearchtartsubnethared-networkerver-nameerver-identifierelect-timeoutendcriptupersedeimestampimeoutoken-ringser-class-host-decl-names-lease-addr-for-default-routeidnknown-clientsendor-class㿘N  H*  ?* : `o *`  kbP@O k!Obh@O} k!Fbp@Ou k!6bx@Om k!=b@Oe ky!?@O]b sq!M kb@OS kg!@b@OK k_!7b@OC kW!9@O;b  O!" kb@O1 kE!b@O) k=!b@O! k5!*@Oc /-!I kc@O k#!Cc@O k!8c @O  kN  k!: @Nc( !c8@O 2N  !kcH@Nܐ k! @NԒcX !! kch@Nʐ kް!cp@N kְ! @Ncx аΰ!4 kc@N kİ!c@N k!@Nc !K kb@N k!c@N k!%@Nc !' kc@N| k!c@Nt k!@NlcЀ !H kc@Nb kv!A@NZc耢 pn!1k @NQc ge! l`@NG l[!`@NY  2T l`@N6 lJ!;@N.` DB!< l`(@N$ l8!B`8@N l0!`@@N l(!#@N `P " !N l`X@N l!@M`` !& l`x@M l!G@M` ! l`@Mސ l!`@M֐ l!+`@Mΐ l!,`@MƐ lڰ!.`@M lҰ!2`@M lʰ!3`@M l°!>@M` !J l`@M l!D`@M k! b@M l!`@M l!`@M| l!`@Mt l!a@Ml l!a@Md lx!/a(@M\ lp!)a0@MT lh!0@MLa8 b`!E laH@MB lV! aX@M: lN!-@M2a` HF!$ lap@MB  l lax@M l3!a@M l+!(@Ma %#!La@M l! @La !5l @LaЀ   !k @Lb ! 0   T  ( < < p exiting.exiting. 㿘! "'H'L'P'T'X@$ "H$@c@ " @Sa !! "o@A@" oa  @ o @SMa(!  o!!a8@Z@@K 㿘! "'H'L'P'T'X@u$ "H$@c " @S& !  @@ oa  @  㿘! "'H'L'P'T'X@K$ "H$@bې " @R !  @ܐ@Ľ oa  @ĸ  㿘! "'H'L'P'T'X@!$ "H$@b " @RҐ !  @β@ē oa  @Ď  %s㿘 " %`N m`@hp(@ &@(. *` 2: .%s line %d: %s%s^^ 㿘 "'H'L'P'T'Xƒ$ "(# ! b4"pВ$@H$@bL! " @Rm " 1 " @Rh b4 P  b0" qp"  @RZ`! & @:@ #oa  @ " @-@  @   "0c @ p` @   "b 㿀@'@@@T 0 ' `  @ *  @?  x@'ؒ@5  ?` ؐ8 @  '@ 0<     *  * ۘ?@  㿀@@@'@ 0 6  `  @ 2@*   '@  x ' `  @ *@*  ܒ @Ȕ ܁㿘@2  @``?㿐   q" a'@Cw  "@t+ 1 q"a(@t$ 1 "     @ ?8" *@  ? @ (8"?(㿘@x<*@ * @`@'   \7///''777  7@ @A   & "*`77ܕ277ސ  7ސ@ @   &㿘@y%d bad IP checksums seen in %d packetsip length %d disagrees with bytes received %d.%d udp packets in %d too long - droppedaccepting packet with data after udp payload.%d bad udp checksums in %d packets㿘@@5  `* & B]  3 b  h&b@ 4h?qb#t&b[& @q# %&5 ``  &1 " ?&"@d 4??r" K&2&""`rm 0` ` 6` ! " $" 1 " &"@3 4?r" `"&"$"?@ 6Can't create dhcp socket: %mCan't set SO_REUSEADDR option on dhcp socket: %mCan't set SO_REUSEPORT option on dhcp socket: %mCan't set SO_BROADCAST option on dhcp socket: %mCan't bind to dhcp address: %mCan't bypass auth IPsec on dhcp socket: %mCan't bypass ESP transport on dhcp socket: %mCan't bypass ESP network on dhcp socket: %m㿀 "   ?/7'  @k  r:" #?'c @j  6'r*"'c"@j  cr"c @j  6r#0@jĔ  6'r#h'  @jϘ ?  " -r#  @j ?  " -r#  @j ? " -rא#Sending on Socket/%s%s%s/㿘{ b<`& 4 s! s"s" s"  send_fallback: %msend_fallback: please consult README file %sregarding broadcast address.㿘 4 @Q ? s" " 3ss"bfallback_discard: %mx   4&'ܒ @)M܀ s#h㿐@ 㿐@  g( 3f+gf# g( 3f+gSf#㿐'@ 㿐'@ؔ 3f g2`* *#3f g2`* *#㿈  @ɻ   @!   @ɯ  @ (7@@ɣ  &㿈@@ə @ɕ   .. eoption-endoption-254option-253option-252option-251option-250option-249option-248option-247option-246option-245option-244option-243option-242option-241option-240option-239option-238option-237option-236option-235option-234option-233option-232option-231option-230option-229option-228option-227option-226option-225option-224option-223option-222option-221option-220option-219option-218option-217option-216option-215option-214option-213option-212option-211option-210option-209option-208option-207option-206option-205option-204option-203option-202option-201option-200option-199option-198option-197option-196option-195option-194option-193option-192option-191option-190option-189option-188option-187option-186option-185option-184option-183option-182option-181option-180option-179option-178option-177option-176option-175option-174option-173option-172option-171option-170option-169option-168option-167option-166option-165option-164option-163option-162option-161option-160option-159option-158option-157option-156option-155option-154option-153option-152option-151option-150option-149option-148option-147option-146option-145option-144option-143option-142option-141option-140option-139option-138option-137option-136option-135option-134option-133option-132option-131option-130option-129option-128option-127option-126option-125option-124option-123option-122option-121option-120option-119option-118option-117option-116option-115option-114option-113option-112option-111option-110option-109option-108option-107option-106option-105option-104option-103option-102option-101option-100option-99option-98option-97option-96option-95option-94option-93option-92option-91option-90option-89option-88nds-contextnds-tree-namends-serversoption-84option-83option-82option-81option-80option-79option-78user-classstreettalk-directory-assistance-serverstreettalk-serverirc-serverfinger-serverwww-servernntp-serverpop-serversmtp-servermobile-ip-home-agentbootfile-nametftp-server-namenisplus-serversnisplus-domainoption-63option-62dhcp-client-identifierdhcp-class-identifierdhcp-rebinding-timedhcp-renewal-timedhcp-max-message-sizedhcp-messageBAdhcp-parameter-request-listdhcp-server-identifierdhcp-message-typedhcp-option-overloaddhcp-lease-timedhcp-requested-addressx-display-managerfont-serversnetbios-scopenetbios-node-typenetbios-dd-servernetbios-name-serversvendor-encapsulated-optionsntp-serversnis-serversnis-domaintcp-keepalive-garbagetcp-keepalive-intervaldefault-tcp-ttlieee802-3-encapsulationarp-cache-timeouttrailer-encapsulationstatic-routesrouter-solicitation-addressrouter-discoverymask-supplierperform-mask-discoverybroadcast-addressall-subnets-localinterface-mtuSApath-mtu-plateau-tableLpath-mtu-aging-timeoutBdefault-ip-ttlmax-dgram-reassemblyIIApolicy-filternon-local-source-routingfip-forwardingextensions-pathroot-pathswap-serverdomain-nametmerit-dumpSboot-sizeXhost-nameresource-location-serversimpress-serverslpr-serverscookie-serverslog-serversdomain-name-serversien116-name-serverstime-serversIAroutersltime-offsetIsubnet-maskpadunknown-255unknown-254unknown-253unknown-252unknown-251unknown-250unknown-249unknown-248unknown-247unknown-246unknown-245unknown-244unknown-243unknown-242unknown-241unknown-240unknown-239unknown-238unknown-237unknown-236unknown-235unknown-234unknown-233unknown-232unknown-231unknown-230unknown-229unknown-228unknown-227unknown-226unknown-225unknown-224unknown-223unknown-222unknown-221unknown-220unknown-219unknown-218unknown-217unknown-216unknown-215unknown-214unknown-213unknown-212unknown-211unknown-210unknown-209unknown-208unknown-207unknown-206unknown-205unknown-204unknown-203unknown-202unknown-201unknown-200unknown-199unknown-198unknown-197unknown-196unknown-195unknown-194unknown-193unknown-192unknown-191unknown-190unknown-189unknown-188unknown-187unknown-186unknown-185unknown-184unknown-183unknown-182unknown-181unknown-180unknown-179unknown-178unknown-177unknown-176unknown-175unknown-174unknown-173unknown-172unknown-171unknown-170unknown-169unknown-168unknown-167unknown-166unknown-165unknown-164unknown-163unknown-162unknown-161unknown-160unknown-159unknown-158unknown-157unknown-156unknown-155unknown-154unknown-153unknown-152unknown-151unknown-150unknown-149unknown-148unknown-147unknown-146unknown-145unknown-144unknown-143unknown-142unknown-141unknown-140unknown-139unknown-138unknown-137unknown-136unknown-135unknown-134unknown-133unknown-132unknown-131unknown-130unknown-129unknown-128unknown-127unknown-126unknown-125unknown-124unknown-123unknown-122unknown-121unknown-120unknown-119unknown-118unknown-117unknown-116unknown-115unknown-114unknown-113unknown-112unknown-111unknown-110unknown-109unknown-108unknown-107unknown-106unknown-105unknown-104unknown-103unknown-102unknown-101unknown-100unknown-99unknown-98unknown-97unknown-96unknown-95unknown-94unknown-93unknown-92unknown-91unknown-90unknown-89unknown-88unknown-87unknown-86unknown-85unknown-84unknown-83unknown-82unknown-81unknown-80unknown-79unknown-78unknown-77unknown-76unknown-75unknown-74unknown-73unknown-72unknown-71unknown-70unknown-69unknown-68unknown-67unknown-66unknown-65unknown-64unknown-63unknown-62unknown-61unknown-60unknown-59unknown-58unknown-57unknown-56unknown-55unknown-54unknown-53unknown-52unknown-51unknown-50unknown-49unknown-48unknown-47unknown-46unknown-45unknown-44unknown-43unknown-42unknown-41unknown-40unknown-39unknown-38unknown-37unknown-36unknown-35unknown-34unknown-33unknown-32unknown-31unknown-30unknown-29unknown-28unknown-27unknown-26unknown-25unknown-24unknown-23unknown-22unknown-21unknown-20unknown-19unknown-18unknown-17unknown-16unknown-15unknown-14unknown-13unknown-12unknown-11unknown-10unknown-9fddiunknown-7token-ringunknown-5unknown-4unknown-3unknown-2ethernetunknown-0dhcpCan't allocate dhcp option hash table.㿘|#p% !$@@ "`|^#x , cx@ , `" @  `@    a""x@"x5 㿐 텒 } {`V0 ; ` ` D0@?ޠsemicolon expected.㿐1 ;}  Ɛ filename must be a stringno memory for string %s.㿐! }Ӑ!@ @A@  }ڐ!` @4 @h  2expecting an identifier in hostnamecan't allocate temp space for hostname.can't allocate space for hostname.㿐  ǒ !!? ! }" TH @@  }"H`@ @g隐@ِ@쿒 .쓒 ."Ȧ@n 2}g"p,@@$@@@@~@ .,@ 2㿘 &@` . @ @ expecting a network hardware typehardware address too longexpecting semicolon.㿐A!$" !K!~0 ~0   .@ .@ .@ Xǐ01'  : @|  & ( `@~ݐ ` `.`@` `" @@ @  ;~Ð Expecting numeric lease time㿐!~!0 @) can't allocate space for numeric aggregatetoo few numbers.unexpected end of fileexpecting numeric value.no temp space for number.can't allocate space for numeric aggregate.㿐  `  "@R & @s:   ~l"p ~Q"b !릒 R } {"~p~5" ;"q m c`?Ӏ! ~! "W  @``: @|@  ~"@q @fI(  )@ے & @:  @~#@``: "@&@T`&`:`@$ @2Bogus number: %s.Bogus number: %s: digit %d not in base %d value %s%o exceeds max (%d) for precision.-value %s%x exceeds max (%d) for precision.value %s%u exceeds max (%d) for precision.Unexpected integer size: %d 㿘L@ -  `2(L@L@ 02# L` x ` ` #\@   `!朗"" L@ `` ? @ /??Ѐ@-L@` *  *@ & "8 "x"h"p c ""h"p W "  "ؐ %. 0!Ғ 0;0, "  " .ē2`00!numeric day of week expected.numeric year expected.expected slash seperating year from month.numeric month expected.expected slash seperating month from day.numeric day of month expected.numeric hour expected.expected colon seperating hour from minute.numeric minute expected.`Đ鲒! u! ;" E  @9''韒! b! ;" 2 @9Ā'l'ܐ8'ܐ鈒 / K! ;"  x! ;"( ;"԰  а @8Đ?'ؐd / '"@ ;"  T! "p ;"  @8'ԐA! " ;" Ԑ @8'А. : " ;"  ! "؀ ;"z v @8'̐  : ΐ" ;"g c ! "؀ ;"W S @8p'Ȑ'' ;} }B ܐ* @*`@*`@,ؑ: `  `?Ԁ`Ȓ*` x   ?* @*`@ *`" * * "@*`@ @ *` *  * "@*`@*`" * 㿘@  @xpsoftdepforcereloadupdatesyncasyncunionrdonlysuidexecdevatimeaccesstimeautorwrogroupquotauserquotao:ffsmount table fullspecified device does not match mounted devicefilesystem not supported by kernel%s on %s: %s @y}'   """c' %#- /  o@e@O@a? ?c* & @ @@@?'`' '' @ ⨀ "  -  0  0  !(!@!p@V ba@ @ usage: mount_ffs [-o options] special node 㿘c @!@ ,-o %s: option not supported㿘@cg  @F 1' n L  o  @` = 2*`"@9 2   @2    &*@&cx@6  @~Ԓp 2L@T㿘@Qhaltdlnpq%sreboot???halted (with powerdown) by %shalted by %srebooted by %s~shutdownSIGTSTP init/etc/rc/dev/consolerevokesetsidopen/bin/shshSIGTERM processesWARNING: some process(es) wouldn't die(can't restart init): h'D@xh'HP ؐ    @> "a @>ΐ a8a0@9H @Ā @ ?2 aP@" @  @ !`@M’ ?J?@?D @ !h@(?@3!x@?2@+!@ ?2 @!! @R @O@L  $@Ȓ@ ̔`'̒ @  !a@<@ @ ?@ ? " @a" @ @@  @,  ?@~ ? "  0@a@ @m ?H!@ usage: %s [-dlnpq] 㿘P <c@@!@ 㿘@ cannot seek temp fileout of memorycannot read temp file㿘 "` {  H  H   "`<  @"   = H @:֔ 6 @[ S#'—  >%#c̠  |$c̔" @f 2c@[֐ @ #c̐? $c!#؀  @H #؀ 3 @{ / $‐?$| $c!#؀  @3 #؀  @f    |@u   H@[ #@ Ұ 0 >  B|= H+|line too longcannot write temp file㿘@ʐ  @[| 7#N 2 #&@+!+ `< ' ࠒ @:D  6@[_ #@! : < H%`<ࠐ @.  ! ?? : H@[F "@ y 0  H<@ $ H <`B< H 㿘! @5 T &X"` T"& `"X$ Tinvalid address㿘 "`@  ``@ @  @@@ `@@ 6#?㿘c"  )"c `X :  A!"`"℀@#"7c"d" /#"" "℀@#"%c̑:!" "℀@#"c "` "b  #"  `@""c̐? #c1#؀  @ #؀ "@Q "/tmp/ed.XXXXXXXXXXw+cannot open temp file㿘"  " (" a @^@t? @Za  "`?@ǐ@Zf@ "? cannot close temp file㿘1  " @z  @ZJ"@ ~" ?& @/"    : H"`< 㿘  @z@"@㿘 `!@(     "` ""`"`*  $*" "((  #"    * 㿘 P"b"*P* * * * * * * @_; @Ҡ   x@2 ,@  㿘#!b"@ "H@*$b$"" b "H `$b?㿘#b ! "H@ $"$b"  b "H*@`$b ?㿘#b  ! "H @$"$b"  b "H@z  ?Enter key: 㿐@i"N  @  @А@2  ? 㿘  @Q!b@ ?Ѐ6Q(K I `F?D `A?? `<?: `7?5 `2?0 `-?+ `(?& ` #?! ` ? ` ? ` ? ` ?  ` ? `? ?