![]() |
seqret |
Because EMBOSS programs can take a wide range of qualifiers that slightly change the behaviour of the program when reading or writing a sequence, this program can do many more things than simply "read and write a sequence".
seqret can read a sequence or many sequences from databases, files, files of sequence names, the command-line or the output of other programs and then can write them to files, the screen or pass them to other programs. Because it can read in a sequence from a database and write it to a file, seqret is a program for extracting sequences from databases. Because it can write the sequence to the screen, seqret is a program for displaying sequences.
seqret can read sequences in any of a wide range of standard sequence formats. You can specify the input and output formats being used. If you don't specify the input format, seqret will try a set of possible formats until it reads it in successfully. Because you can specify the output sequence format, seqret is a program to reformat a sequence.
seqret can read in the reverse complement of a nucleic acid sequence. It therefore is a program for producing the reverse complement of a sequence.
seqret can read in a sequence whose begin and end positions you have specified and write out that fragment. It is therefore a utility for doing simple extraction of a region of a sequence.
seqret can change the case of the sequence being read in to upper or to lower case. It is therefore a simple sequence beautification utility.
seqret can do any combination of the above functions.
The sequence input and output specification of this (and many other EMBOSS programs) is described as being a Uniform Sequence Address.
The Uniform Sequence Address, or USA, is a somewhat tongue-in-cheek reference to a URL-style sequence naming used by all EMBOSS applications.
The USA is a very flexible way of specifying one or more sequences from a variety of sources and includes sequence files, database queries and external applications.
See the full specification of USA syntax at:
http://www.uk.embnet.org/Software/EMBOSS/Themes/UniformSequenceAddress.html
The basic USA syntax is one of:
Note that ':' separates the name of a file containing many possible entries from the specific name of a sequence entry in that file. It also separates the name of a database from an entry in that database
Note also that '::' separates the specified format of a file from the name of the file. Normally the format can be omitted, in which case the program will attempt to identify the correct format when reading the sequence in and will default to using FASTA format when writing the sequence out.
Valid names of the databases set up in your local implementation of EMBOSS can be seen by using the program 'showdb'.
Database queries, and individual entries in files that have more than one sequence entry, use wildcards of "?" for any character and "*" for any string of characters. There are some problems with the Unix shell catching these characters so they do need to be hidden in quotes or preceded by a backslash on the Unix command line, (for example "embl:hs\*")
The output USA name 'stdout' is special. It makes the output go to the device 'standard output'. This is the screen, by default.
USA | Description |
---|---|
xxx.seq | A sequence file "xxx.seq" in any format |
fasta::xxx.seq | A sequence file "xxx.seq" in fasta format |
gcg::egmsmg.gcg | A sequence file "egmsmg.gcg" in GCG 9 format |
egmsmg.gcg -sformat=gcg | A sequence file "egmsmg.gcg" in GCG 9 format |
embl::paamir.em | A sequence file "paamir.em" in EMBL format |
embl:paamir | EMBL entry PAAMIR, using whatever access method is defined locally for the EMBL database |
embl:X13776 | EMBL entry X13776, using whatever access method is defined locally for the EMBL database and searching by accession number and entry name (X13776 is the accession number in this case) |
embl-acc:X13776 | EMBL entry X13776, using whatever access method is defined locally for the EMBL database and searching by accession number only |
embl-id:paamir | EMBL entry PAAMIR, using whatever access method is defined locally for the EMBL database, and searching by ID only |
embl:paami* | EMBL entries PAAMIB, PAAMIE and so on, usually in alphabetical order, using whatever access method is defined locally for the EMBL database |
embl or EMBL:* | All sequences in the EMBL database |
@mylist | Reads file mylist and uses each line as a separate USA. This is standard VMS list file syntax, also used in SRS 4.0 but missing in SRS 5.0. The list file is a list of USAs (one per line). List files can contain references to other lists files or any other standard USA. |
list::mylist | Same as "@mylist" above |
'getz -e [embl-id:paamir] |' | The pipe character "|" causes EMBOSS to fire up getz (SRS 5.1) to extract entry PAAMIR from EMBL in EMBL format. Any application or script which writes one or more sequences to stdout can be used in this way. |
asis::atacgcagttatctgaccat | So far the shortest USA we could invent. In 'asis' format the name is the sequence so no file needs to be opened. This is a special case. It was intended as a joke, but could be quite useful for generating command lines. |
By default, (i.e. if no format is explicitly specified) EMBOSS tries each format in turn until one succeeds.
Input Format | Comments |
---|---|
gcg | GCG 9.x and 10.x format with the format and sequence type identified on the first line of the file |
gcg8 | GCG 8.x format where anything up to the first line containing ".." is considered as heading, and the remainder is sequence data. This format is complicated by the header appearing to be in other formats such as EMBL, and by the possibility of reading a large amount of data in the wrong format before discovering that there is no ".." line because it is not GCG format after all. |
embl em | EMBL entry format, or at least a minimal subset of the fields. The Staden package and others use EMBL or similar formats for sequence data. |
swiss sw | SWISSPROT entry format, or at least a minimal subset of the fields. |
fasta pearson |
FASTA format with an optional accession number after the sequence
identifier, eg:
>name description or >name accession description and with an optional database name in GCG style fasta format included as part of the sequence identifier, eg: >database:name accession description |
ncbi |
FASTA format with optional accession number and database name in NCBI
style included as part of the sequence identifier.
eg
>database|accession|id description (and other variants on this theme!) |
genbank gb | GENBANK entry format, or at least a minimal subset of the fields. |
nbrf pir | NBRF (PIR) format, as used in the PIR database sequence files. |
codata | CODATA format. |
strider | DNA strider format |
clustal aln | ClustalW ALN (multiple alignment) format. |
phylip | PHYLIP non-interleaved multiple alignment format. |
acedb | ACeDB format |
msf | Wisconsin Package GCG's MSF multiple sequence format. |
hennig86 | Hennig86 format |
jackknifer | Jackknifer format |
jackknifernon | Jackknifernon format |
nexus paup | Nexus/PAUP format |
nexusnon paupnon | Nexusnon/PAUPnon format |
treecon | Treecon format |
mega | Mega format |
meganon | Meganon format |
ig | IntelliGenetics format. |
staden experiment | The experiment file format used by the "gap" program in the Staden package, where the sequence identifier is optional and the remainer is plain text. Some alternative nucleotide ambiguity codes are used and must be converted. |
unknown text plain | Plain text. This is the format with no format. The whole of the file is read in as a sequence. No attempt is made to parse the file contents in any way. Anything is acceptable in this format. |
raw | Like unknown/text/plain format except that it accepts only alphanumeric and whitespace characters and rejects anything else. |
asis |
This is not so much a sequence format as a quick way of entering a
sequence on the command line, but it is included here for completeness.
Where a filename would normally be given, in asis format there is
the sequence itself.
An example would be:
asis::atacgcagttatctgaccat In 'asis' format the name is the sequence so no file needs to be opened. This is a special case. It was intended as a joke, but could be quite useful for generating command lines. |
Some sequence formats can hold multiple sequences in one file, these are marked as multiple in the following table. The details of how many sequences are held in one file differs between formats, but they either allow many sequences to be concatenated one after the other, or they hold the sequences together in some sort of aligned set of sequences.
Other formats, such as GCG, plain and staden formats can only hold one sequence per file, these are marked as single. An attempt to concatenate several sequences in one file leaves the results as a mess that makes it impossible to decide where the sequences start and end or what is annotation and what is sequence.
These single formats therefore cause problems when there are multiple sequences to write out because a single file containing multiple sequences in that format is invalid. When these formats are specified for output, an EMBOSS program will allow you to write many sequences to one file, but EMBOSS programs will not be able to reliably read in the resulting mess.
N.B This behaviour changed in EMBOSS version 1.7.0. (31 Oct 2000) Previously, EMBOSS programs that were asked to write multiple sequences in a single format whould ignore the requested output file name and would write each sequence into a separate file whose name was constructed from the sequence name and the name of the format. This resulted in ouput to files whose names could not be reliably controlled. A decision was taken that EMBOSS users were intelligent people who could live with the consequences of their actions and who could learn not to write out multiple sequences to a file in formats that could not cope with multiple sequences.
It you really wish to write multiple sequences out in formats that can not cope with multiple sequences, you are advised to add the global qualifier -ossingle on the command line. This will force the EMBOSS program to ignore the given output file name and will generate its own file names. One sequence will be written to each such file. These file names are made from the sequence ID name, with the name of the format as the extension (e.g. hsfau.gcg).
This is not ideal. Preferably, you should stay away from formats that can't cope with multiple sequences in a file.
Output Format | Single/ Multiple | Comments |
---|---|---|
gcg | single | Wisconsin Package GCG 9.x and 10.x format with the sequence type on the first line of the file. |
gcg8 | single | GCG 8.x format where anything up to the first line containing ".." is considered as heading, and the remainder is sequence data. |
embl em | multiple | EMBL entry format with available fields filled in and others with no infomation omitted. The EMBOSS command line allows missing data such as accession numbers to be provided if they are not obtainable from the input sequence. |
swiss sw | multiple | SwisProt entry format with available fields filled in and others with no infomation omitted. The EMBOSS command line allows missing data such as accession numbers to be provided if they are not obtainable from the input sequence. |
fasta | multiple | Standard Pearson FASTA format, but with the accession number included after the identifier if available. |
pearson | multiple | Simple Pearson FASTA format, an alias for "fasta" format. |
ncbi | multiple | NCBI style FASTA format with the database name, entry name and accession number separated by pipe ("|") characters. |
nbrf pir | multiple | NBRF (PIR) format, as used in the PIR database sequence files. |
genbank gb | multiple | GENBANK entry format with available fields filled in and others with no infomation omitted. The EMBOSS command line allows missing data such as accession numbers to be provided if they are not obtainable from the input sequence. |
ig | multiple | Intelligenetics format, as used by the Intelligenetics package |
codata | multiple | CODATA format. |
strider | multiple | DNA strider format |
acedb | multiple | ACeDB format |
staden experiment | single | The experiment file format used by the "gap" program in the Staden package. Some alternative nucleotide ambiguity codes are used and are converted. |
text plain raw | single | Plain sequence, no annotation or heading. |
fitch | multiple | Fitch format |
msf | multiple | Wisconsin Package GCG's MSF multiple sequence format. |
clustal aln | multiple | Clustal multiple sequence format. |
phylip | multiple | PHYLIP non-interleaved format. |
phylip3 | multiple | PHYLIP interleaved format. |
asn1 | multiple | A subset of ASN.1 containing entry name, accession number, description and sequence, similar to the current ASN.1 output of readseq |
hennig86 | multiple | Hennig86 format |
mega | multiple | Mega format |
meganon | multiple | Meganon format |
nexus paup | multiple | Nexus/PAUP format |
nexusnon paupnon | multiple | Nexusnon/PAUPnon format |
jackknifer | multiple | Jackknifer format |
jackknifernon | multiple | Jackknifernon format |
treecon | multiple | Treecon format |
debug | multiple | EMBOSS sequence object report for debugging showing all available fields. Not all fields will contain data - this depends very much on the input format used. |
As noted previously there are many 'associated' qualifiers that alter the behaviour of seqret when it reads in or writes out a sequence. As these are used in all EMBOSS programs that read in or write out sequences, they are not reported by the '-help' qualifier. They are however reported by the pair of qualifiers: '-help -verbose':
Some of the more useful associated qualifiers are:
Qualifier | Description |
---|---|
-sbegin | The first position to be used in the sequence |
-send | The last position to be used in the sequence |
-sreverse | Use the reverse complement of a nucleic acid sequence |
-sask | Ask the user for begin/end/reverse information |
-slower | Convert the sequence to lower case |
-supper | Convert the sequence to upper case |
-sformat | Specify the input sequence format |
-osformat | Specify the output sequence format |
-ossingle | Write each entry into a separate file |
-auto | Turn off prompts and don't report the one-line description |
-stdout | Write the results to 'standard output' (the screen) |
-filter | Read input from another program, write to the screen |
-options | Prompt for optional qualifiers |
-help | Display a table of the command-line options |
The set of associated qualifiers for sequences behave in different ways depending on where they appear.
If these qualifiers immediately follow a parameter they apply only to that parameter and not to all cases. If they occur before any parameters, they apply to all following sequence parameters.
If there are no two parameters of equal type, the order of parameters and their qualifiers is irrelevant.
Where a qualifier is defined more than once, for example "-sformat" for 2 input sequences to be aligned, the qualifier name can have a number to indicate which sequence is meant. "-sbegin2=25" will apply only to the second sequence, no matter where it appears on the command line.
The -sbegin and -send qualifiers take an integer number specifying the position to begin or end reading a sequence. If the number is positive, the number is the position counting from the first base or residue of the sequence. If the number is negative the position is counted from the end of the sequence, so position -1 is the last base or residue of the sequence. (If -sbegin 0 is used, it is assumed to be the same as -sbegin 1 and -send 0 is the same as -send -1.)
The filter qualifier makes the program behave like a filter, reading its (first) input 'file' from the standard input, and writing its (first) output 'file' to the standard output. The -filter qualifier will also invoke the -auto qualifier, so the user is never prompted for any missing values.
Example:
% cat sequence.seq | seqret -filter | lpr
The example shows the application seqret being run with the -filter qualifier. The input file is 'piped' into the program using the unix command cat and the output is 'piped' directly to the unix program lpr, which will print it on the printer.
When the -options qualifier is used and not all the parameters are given on the command line, it will query the user for those parameters. It will not only query the user for the required parameters as it would do without the -options qualifier, but it will also query the user for the optional parameters.
When the -stdout qualifier is used, the user will still be prompted for all the info that is required, but will write to standard output by default. The user will also still be prompted for an output filename, in case the user wants to save the output to a file.
Extract an entry from a database and write it to a file:
% seqret Reads and writes (returns) sequences Input sequence(s): tembl:hsfau Output sequence [hsfau.fasta]: |
Go to the input files for this example
Go to the output files for this example
Example 2
Read all entries in the database 'tembl' that start with 'hs' and write them to a file. In this example the specification is all done in the command line and to stop Unix getting confused by the '*' character, it has to have a backslash ('\') before it:
% seqret tembl:hs\* hsall.seq Reads and writes (returns) sequences |
Go to the output files for this example
Example 3
seqret does not read in features by default because this results in slightly faster performance. If however you wish to read in features with your sequence and write them out on output, using '-feature' will change the default behaviour to use any features present in the sequence. N.B. use embl format for the output file as the default format 'fasta' reports the features in gff (file "<seqname>.gff")
% seqret -feature Reads and writes (returns) sequences Input sequence(s): tembl:hsfau Output sequence [hsfau.fasta]: embl::hsfau.embl |
Go to the output files for this example
Example 4
Display the contents of the sequence on the screen:
% seqret Reads and writes (returns) sequences Input sequence(s): tembl:hsfau Output sequence [hsfau.fasta]: stdout >HSFAU X65923.1 H.sapiens fau mRNA ttcctctttctcgactccatcttcgcggtagctgggaccgccgttcagtcgccaatatgc agctctttgtccgcgcccaggagctacacaccttcgaggtgaccggccaggaaacggtcg cccagatcaaggctcatgtagcctcactggagggcattgccccggaagatcaagtcgtgc tcctggcaggcgcgcccctggaggatgaggccactctgggccagtgcggggtggaggccc tgactaccctggaagtagcaggccgcatgcttggaggtaaagttcatggttccctggccc gtgctggaaaagtgagaggtcagactcctaaggtggccaaacaggagaagaagaagaaga agacaggtcgggctaagcggcggatgcagtacaaccggcgctttgtcaacgttgtgccca cctttggcaagaagaagggccccaatgccaactcttaagtcttttgtaattctggctttc tctaataaaaaagccacttagttcagtcaaaaaaaaaa |
Example 5
Write the result in GCG format by using the qualifier '-osformat'.
% seqret -osf gcg Reads and writes (returns) sequences Input sequence(s): tembl:hsfau Output sequence [hsfau.gcg]: |
Go to the output files for this example
Example 6
Write the result in GCG format by specifying the format in the output USA on the command line.
% seqret -outseq gcg::hsfau.gcg Reads and writes (returns) sequences Input sequence(s): tembl:hsfau |
Example 7
Write the result in GCG format by specifying the format in the output USA at the prompt.
% seqret Reads and writes (returns) sequences Input sequence(s): tembl:hsfau Output sequence [hsfau.fasta]: gcg::hsfau.gcg |
Example 8
Write the reverse-complement of a sequence:
% seqret -srev Reads and writes (returns) sequences Input sequence(s): tembl:hsfau Output sequence [hsfau.fasta]: |
Go to the output files for this example
Example 9
Extract the bases between the positions starting at 5 and ending at 25:
% seqret -sbegin 5 -send 25 Reads and writes (returns) sequences Input sequence(s): tembl:hsfau Output sequence [hsfau.fasta]: |
Go to the output files for this example
Example 10
Extract the bases between the positions starting at 5 and ending at 5 bases before the end of the sequence:
% seqret -sbegin 5 -send -5 Reads and writes (returns) sequences Input sequence(s): tembl:hsfau Output sequence [hsfau.fasta]: |
Go to the output files for this example
Example 11
Read all entries in the database 'tembl' that start with 'hs' and write them to a file:
% seqret Reads and writes (returns) sequences Input sequence(s): tembl:hs* Output sequence [hs989235.fasta]: hsall.seq |
Mandatory qualifiers: [-sequence] seqall Sequence database USA [-outseq] seqoutall Output sequence(s) USA Optional qualifiers: (none) Advanced qualifiers: -feature boolean Use feature information -firstonly boolean Read one sequence and stop Associated qualifiers: "-sequence" related qualifiers -sbegin1 integer First base used -send1 integer Last base used, def=seq length -sreverse1 boolean Reverse (if DNA) -sask1 boolean Ask for begin/end/reverse -snucleotide1 boolean Sequence is nucleotide -sprotein1 boolean Sequence is protein -slower1 boolean Make lower case -supper1 boolean Make upper case -sformat1 string Input sequence format -sopenfile1 string Input filename -sdbname1 string Database name -sid1 string Entryname -ufo1 string UFO features -fformat1 string Features format -fopenfile1 string Features file name "-outseq" related qualifiers -osformat2 string Output seq format -osextension2 string File name extension -osname2 string Base file name -osdirectory2 string Output directory -osdbname2 string Database name to add -ossingle2 boolean Separate file for each entry -oufo2 string UFO features -offormat2 string Features format -ofname2 string Features file name -ofdirectory2 string Output directory General qualifiers: -auto boolean Turn off prompts -stdout boolean Write standard output -filter boolean Read standard input, write standard output -options boolean Prompt for required and optional values -debug boolean Write debug output to program.dbg -acdlog boolean Write ACD processing log to program.acdlog -acdpretty boolean Rewrite ACD file as program.acdpretty -acdtable boolean Write HTML table of options -verbose boolean Report some/full command line options -help boolean Report command line options. More information on associated and general qualifiers can be found with -help -verbose -warning boolean Report warnings -error boolean Report errors -fatal boolean Report fatal errors -die boolean Report deaths |
Mandatory qualifiers | Allowed values | Default | |
---|---|---|---|
[-sequence] (Parameter 1) |
Sequence database USA | Readable sequence(s) | Required |
[-outseq] (Parameter 2) |
Output sequence(s) USA | Writeable sequence(s) | <sequence>.format |
Optional qualifiers | Allowed values | Default | |
(none) | |||
Advanced qualifiers | Allowed values | Default | |
-feature | Use feature information | Boolean value Yes/No | No |
-firstonly | Read one sequence and stop | Boolean value Yes/No | No |
ID HSFAU standard; RNA; HUM; 518 BP. XX AC X65923; XX SV X65923.1 XX DT 13-MAY-1992 (Rel. 31, Created) DT 23-SEP-1993 (Rel. 37, Last updated, Version 10) XX DE H.sapiens fau mRNA XX KW fau gene. XX OS Homo sapiens (human) OC Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; OC Eutheria; Primates; Catarrhini; Hominidae; Homo. XX RN [1] RP 1-518 RA Michiels L.M.R.; RT ; RL Submitted (29-APR-1992) to the EMBL/GenBank/DDBJ databases. RL L.M.R. Michiels, University of Antwerp, Dept of Biochemistry, RL Universiteisplein 1, 2610 Wilrijk, BELGIUM XX RN [2] RP 1-518 RX MEDLINE; 93368957. RA Michiels L., Van der Rauwelaert E., Van Hasselt F., Kas K., Merregaert J.; RT " fau cDNA encodes a ubiquitin-like-S30 fusion protein and is expressed as RT an antisense sequences in the Finkel-Biskis-Reilly murine sarcoma virus"; RL Oncogene 8:2537-2546(1993). XX DR SWISS-PROT; P35544; UBIM_HUMAN. DR SWISS-PROT; Q05472; RS30_HUMAN. XX FH Key Location/Qualifiers FH FT source 1..518 FT /chromosome="11q" FT /db_xref="taxon:9606" FT /organism="Homo sapiens" FT /tissue_type="placenta" FT /clone_lib="cDNA" FT /clone="pUIA 631" FT /map="13" FT misc_feature 57..278 FT /note="ubiquitin like part" FT CDS 57..458 FT /db_xref="SWISS-PROT:P35544" FT /db_xref="SWISS-PROT:Q05472" FT /gene="fau" FT /protein_id="CAA46716.1" FT /translation="MQLFVRAQELHTFEVTGQETVAQIKAHVASLEGIAPEDQVVLLAG FT APLEDEATLGQCGVEALTTLEVAGRMLGGKVHGSLARAGKVRGQTPKVAKQEKKKKKTG FT RAKRRMQYNRRFVNVVPTFGKKKGPNANS" FT misc_feature 98..102 FT /note="nucleolar localization signal" FT misc_feature 279..458 FT /note="S30 part" FT polyA_signal 484..489 FT polyA_site 509 XX SQ Sequence 518 BP; 125 A; 139 C; 148 G; 106 T; 0 other; ttcctctttc tcgactccat cttcgcggta gctgggaccg ccgttcagtc gccaatatgc 60 agctctttgt ccgcgcccag gagctacaca ccttcgaggt gaccggccag gaaacggtcg 120 cccagatcaa ggctcatgta gcctcactgg agggcattgc cccggaagat caagtcgtgc 180 tcctggcagg cgcgcccctg gaggatgagg ccactctggg ccagtgcggg gtggaggccc 240 tgactaccct ggaagtagca ggccgcatgc ttggaggtaa agttcatggt tccctggccc 300 gtgctggaaa agtgagaggt cagactccta aggtggccaa acaggagaag aagaagaaga 360 agacaggtcg ggctaagcgg cggatgcagt acaaccggcg ctttgtcaac gttgtgccca 420 cctttggcaa gaagaagggc cccaatgcca actcttaagt cttttgtaat tctggctttc 480 tctaataaaa aagccactta gttcagtcaa aaaaaaaa 518 // |
If the '-firstonly' qualifier is used then only the first sequence of the input USA specification will be written out.
In some cases the output filename will be the same as the input filename, but as seqret reads only the first sequence before opening the output file it may try to overwrite the input. Note that this is not true of seqretset which reads all sequences into memory at startup, but which can need a large amount of memory for many sequences.
>HSFAU X65923.1 H.sapiens fau mRNA ttcctctttctcgactccatcttcgcggtagctgggaccgccgttcagtcgccaatatgc agctctttgtccgcgcccaggagctacacaccttcgaggtgaccggccaggaaacggtcg cccagatcaaggctcatgtagcctcactggagggcattgccccggaagatcaagtcgtgc tcctggcaggcgcgcccctggaggatgaggccactctgggccagtgcggggtggaggccc tgactaccctggaagtagcaggccgcatgcttggaggtaaagttcatggttccctggccc gtgctggaaaagtgagaggtcagactcctaaggtggccaaacaggagaagaagaagaaga agacaggtcgggctaagcggcggatgcagtacaaccggcgctttgtcaacgttgtgccca cctttggcaagaagaagggccccaatgccaactcttaagtcttttgtaattctggctttc tctaataaaaaagccacttagttcagtcaaaaaaaaaa |
>HS989235 H45989.1 yo13c02.s1 Soares adult brain N2b5HB55Y Homo sapiens cDNA clone IMAGE:177794 3', mRNA sequence. ccggnaagctcancttggaccaccgactctcgantgnntcgccgcgggagccggntggan aacctgagcgggactggnagaaggagcagagggaggcagcacccggcgtgacggnagtgt gtggggcactcaggccttccgcagtgtcatctgccacacggaaggcacggccacgggcag gggggtctatgatcttctgcatgcccagctggcatggccccacgtagagtggnntggcgt ctcggtgctggtcagcgacacgttgtcctggctgggcaggtccagctcccggaggacctg gggcttcagcttcccgtagcgctggctgcagtgacggatgctcttgcgctgccatttctg ggtgctgtcactgtccttgctcactccaaaccagttcggcggtccccctgcggatggtct gtgttgatggacgtttgggctttgcagcaccggccgccgagttcatggtngggtnaagag atttgggttttttcn >HSCAD5 X59796.1 H.sapiens mRNA for cadherin-5 ctccactcacgctcagccctggacggacaggcagtccaacggaacagaaacatccctcag cccacaggcacgatctgttcctcctgggaagatgcagaggctcatgatgctcctcgccac atcgggcgcctgcctgggcctgctggcagtggcagcagtggcagcagcaggtgctaaccc tgcccaacgggacacccacagcctgctgcccacccaccggcgccaaaagagagattggat ttggaaccagatgcacattgatgaagagaaaaacacctcacttccccatcatgtaggcaa gatcaagtcaagcgtgagtcgcaagaatgccaagtacctgctcaaaggagaatatgtggg caaggtcttccgggtcgatgcagagacaggagacgtgttcgccattgagaggctggaccg ggagaatatctcagagtaccacctcactgctgtcattgtggacaaggacactggcgaaaa cctggagactccttccagcttcaccatcaaagttcatgacgtgaacgacaactggcctgt gttcacgcatcggttgttcaatgcgtccgtgcctgagtcgtcggctgtggggacctcagt catctctgtgacagcagtggatgcagacgaccccactgtgggagaccacgcctctgtcat gtaccaaatcctgaaggggaaagagtattttgccatcgataattctggacgtattatcac aataacgaaaagcttggaccgagagaagcaggccaggtatgagatcgtggtggaagcgcg agatgcccagggcctccggggggactcgggcacggccaccgtgctggtcactctgcaaga catcaatgacaacttccccttcttcacccagaccaagtacacatttgtcgtgcctgaaga cacccgtgtgggcacctctgtgggctctctgtttgttgaggacccagatgagccccagaa ccggatgaccaagtacagcatcttgcggggcgactaccaggacgctttcaccattgagac aaaccccgcccacaacgagggcatcatcaagcccatgaagcctctggattatgaatacat ccagcaatacagcttcatagtcgaggccacagaccccaccatcgacctccgatacatgag ccctcccgcgggaaacagagcccaggtcattatcaacatcacagatgtggacgagccccc cattttccagcagcctttctaccacttccagctgaaggaaaaccagaagaagcctctgat tggcacagtgctggccatggaccctgatgcggctaggcatagcattggatactccatccg caggaccagtgacaagggccagttcttccgagtcacaaaaaagggggacatttacaatga gaaagaactggacagagaagtctacccctggtataacctgactgtggaggccaaagaact ggattccactggaacccccacaggaaaagaatccattgtgcaagtccacattgaagtttt ggatgagaatgacaatgccccggagtttgccaagccctaccagcccaaagtgtgtgagaa cgctgtccatggccagctggtcctgcagatctccgcaatagacaaggacataacaccacg aaacgtgaagttcaaattcatcttgaatactgagaacaactttaccctcacggataatca cgataacacggccaacatcacagtcaagtatgggcagtttgaccgggagcataccaaggt ccacttcctacccgtggtcatctcagacaatgggatgccaagtcgcacgggcaccagcac gctgaccgtggccgtgtgcaagtgcaacgagcagggcgagttcaccttctgcgaggatat ggccgcccaggtgggcgtgagcatccaggcagtggtagccatcttactctgcatcctcac catcacagtgatcaccctgctcatcttcctgcggcggcggctccggaagcaggcccgcgc gcacggcaagagcgtgccggagatccacgagcagctggtcacctacgacgaggagggcgg cggcgagatggacaccaccagctacgatgtgtcggtgctcaactcggtgcgccgcggcgg ggccaagcccccgcggcccgcgctggacgcccggccttccctctatgcgcaggtgcagaa gccaccgaggcacgcgcctggggcacacggagggcccggggagatggcagccatgatcga ggtgaagaaggacgaggcggaccacgacggcgacggccccccctacgacacgctgcacat ctacggctacgagggctccgagtccatagccgagtccctcagctccctgggcaccgactc [Part of this file has been deleted for brevity] aacaaaaaaagagaatgttacaccaatatccttgatgaacatcgatgcaaaaatcctcaa taaaatactggcaaactgaatccagcagcacatcaaaaagcttatcctccatgatcaagt gggcttcatccctgccatgcaaggctggttcaacatacgaaatcaataaacataatccag catataaacagaaccaaagacacaaaccatatgattatctcaatagatgcagaaaaggcc tttgacaaaattcaacaatgcttcatgctaaaaactctcaataaattaggtattgatggg acatatctcaaaataataagagctatctatgacaaacccacagccaatatcatactgagt ggacaaaaactggaagcattccctttgaaaactggcacaaggcagggatgccctctctca ccactcctattcaacatagtgttggaagttctggccagggcaatcaggcaggagaaggaa ataaagggcattcaattaggaaaagaggaaggtgaaattgtccctgtttgcagatgacat gattgtatatctagaaaaccccattgtctcagcccaaaatctccttaagctgataagcaa cttcagcaaagtctcaggatataaaatcagtgtgcaaaaatcacaagtattcctatgcac caataacagacaaacagagagccaaatcatgagtgaactcccattcacaattgcttcaaa gagaataaaatacctaggaatccaacttacaagggatgtgaaggacctcttcaaggagaa ctacaaaccactgctcaatgaaataaaagaggatacaaacaaatggaagaacattccatg cttatgggtaggaagaatcatatcgtgaaaatggtcatactgcccaaggtaatttataga ttcaatgccatccccatcaagctaccaatgactttcttcacagaactggaaaaaactact ttaaagttcatatggaatcaaaaaagagcccacatcaccaaggcaatcctaagccaaaag aacaaagctggaggcatcacgctacctgacttcaaactatactacaatgctacggtaacc aaaacagcatggtactggtaccaaaacagagatctagaccaatggaacagaacagagccc tcagaaataatgccgcatatctacaactatccgatctttgacaaacctgagagaaacaag caatggggaaaggattccctatttaataaatggtgctgggaaaactggctagccatatgt agaaagctgaaactggatccttccttacaccttatacaaaaattaattcaagatggatta aagacttaaacattagacctaaaaccataaaaaccctagaaaaaaacctaggcaatacca ttcaggacataggcatgggcaaggacttcatgtctaaaacaccaaaacgaatggcaacaa aagacaaaatggacaaacgggatctaattaaactaaagagcttctgcacagctaaagaaa ctaccatcagagtgaacaggcaacctacaaaatgggagaaaatttttgcaatctactcat ctgacaaagggctaatatccagaatctacaatgaactcaaacaaatttacaagaaaaaac aaacaaccccatcaaaaagtgggcaaaggatatgaacagacacttctcaaaagaagacat ttatgtaatcaaaaaacacatgaaaaaatgctcatcatcactagccatcagagaaatgca aatcaaaaccacaatgagataccatctcacaccagttagaatggcgatcattaaaaagtc aggaaacaacaggtgctggagaggatgtggagaaacaggaacaacttttacactgttggt gggactgtaaactagttcaaccattgcggaagtcagtgtggcaattcctcaggaatctag aactagaaataccatttgacccagccatcccattactgggtagatacccaaaggattata aatcatgctgctataaagacacatgcacacgtatgtttattgcagcactattcacaatag caaagacttggaaccaacccaaatgtccaacaacgatagattggattaagaaaatgtggc acatatacaccatggaatactatgcagccataaaaaatgatgagttcatgtcctttgtag ggacatggatgaagctggaaactatcattctcagcaaactatcacaaggacaataaacca aacaccgcatgttctcactcataggtgggaattgaacaatgagaacacatggacacatga agaggaacatcacactctggggactgttatggggtggggggcaggggcagggatagcact aggagatatacctaatgctaaatgacgagttaatgggtgcagcacaccaacatggcacat gtatacatatataacaaacctgccgttgtgcacatgtaccctaaaacttgaagtataata ataaaaaaaagttatcctattaaaactgatctcacacatccgtagagccattatcaagtc tttctctttgaaacagacagaaatttagtgttttctcagtcagttaac >HSA203YC1 Z52466.1 H.sapiens (D1S2660) DNA segment containing (CA) repeat; clone AFMa203yc1; single read. agctgtgtgcacacaacatganggggcacacatgcacatgcacacatgcccacatgcata tgcacacacacacacacacacacacacacattcatgcccaagcacgcccaccctcatgtc tcaccatgtgcacataacacacagtcacatataccctggcacacatgcccacatgcagac acgaaacacaggcccacgnttncatgcacacaggtatgggcacacataccatgcacacat aangacaaataccaggccagacatgatttgcccctgctggtgtcactgttaagtgtgaca gacaagcagaggacacacacccacctgggacgcggggcttcaggagagaggcagacctaa tagggcccggattcggggctggggaggct |
ID HSFAU standard; DNA; UNC; 518 BP. AC X65923; SV X65923.1 DE H.sapiens fau mRNA KW fau gene. OS Homo sapiens (human) OC Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; OC Mammalia; Eutheria; Primates; Catarrhini; Hominidae; Homo. FH Key Location/Qualifiers FH FT source 1..518 FT /chromosome="11q" FT /db_xref="taxon:9606" FT /organism="Homo sapiens" FT /tissue_type="placenta" FT /clone_lib="cDNA" FT /clone="pUIA 631" FT /map="13" FT misc_feature 57..278 FT /note="ubiquitin like part" FT CDS 57..458 FT /db_xref="SWISS-PROT:P35544" FT /db_xref="SWISS-PROT:Q05472" FT /gene="fau" FT /protein_id="CAA46716.1" FT /translation="MQLFVRAQELHTFEVTGQETVAQIKAHVASLEGIAPEDQVVLLAG FT APLEDEATLGQCGVEALTTLEVAGRMLGGKVHGSLARAGKVRGQTPKVAKQEKKKKKTG FT RAKRRMQYNRRFVNVVPTFGKKKGPNANS" FT misc_feature 98..102 FT /note="nucleolar localization signal" FT misc_feature 279..458 FT /note="S30 part" FT polyA_signal 484..489 FT polyA_site 509 SQ Sequence 518 BP; 125 A; 139 C; 148 G; 106 T; 0 other; ttcctctttc tcgactccat cttcgcggta gctgggaccg ccgttcagtc gccaatatgc 60 agctctttgt ccgcgcccag gagctacaca ccttcgaggt gaccggccag gaaacggtcg 120 cccagatcaa ggctcatgta gcctcactgg agggcattgc cccggaagat caagtcgtgc 180 tcctggcagg cgcgcccctg gaggatgagg ccactctggg ccagtgcggg gtggaggccc 240 tgactaccct ggaagtagca ggccgcatgc ttggaggtaa agttcatggt tccctggccc 300 gtgctggaaa agtgagaggt cagactccta aggtggccaa acaggagaag aagaagaaga 360 agacaggtcg ggctaagcgg cggatgcagt acaaccggcg ctttgtcaac gttgtgccca 420 cctttggcaa gaagaagggc cccaatgcca actcttaagt cttttgtaat tctggctttc 480 tctaataaaa aagccactta gttcagtcaa aaaaaaaa 518 // |
!!NA_SEQUENCE 1.0 H.sapiens fau mRNA HSFAU Length: 518 Type: N Check: 2981 .. 1 ttcctctttc tcgactccat cttcgcggta gctgggaccg ccgttcagtc 51 gccaatatgc agctctttgt ccgcgcccag gagctacaca ccttcgaggt 101 gaccggccag gaaacggtcg cccagatcaa ggctcatgta gcctcactgg 151 agggcattgc cccggaagat caagtcgtgc tcctggcagg cgcgcccctg 201 gaggatgagg ccactctggg ccagtgcggg gtggaggccc tgactaccct 251 ggaagtagca ggccgcatgc ttggaggtaa agttcatggt tccctggccc 301 gtgctggaaa agtgagaggt cagactccta aggtggccaa acaggagaag 351 aagaagaaga agacaggtcg ggctaagcgg cggatgcagt acaaccggcg 401 ctttgtcaac gttgtgccca cctttggcaa gaagaagggc cccaatgcca 451 actcttaagt cttttgtaat tctggctttc tctaataaaa aagccactta 501 gttcagtcaa aaaaaaaa |
>HSFAU X65923.1 H.sapiens fau mRNA ttttttttttgactgaactaagtggcttttttattagagaaagccagaattacaaaagac ttaagagttggcattggggcccttcttcttgccaaaggtgggcacaacgttgacaaagcg ccggttgtactgcatccgccgcttagcccgacctgtcttcttcttcttcttctcctgttt ggccaccttaggagtctgacctctcacttttccagcacgggccagggaaccatgaacttt acctccaagcatgcggcctgctacttccagggtagtcagggcctccaccccgcactggcc cagagtggcctcatcctccaggggcgcgcctgccaggagcacgacttgatcttccggggc aatgccctccagtgaggctacatgagccttgatctgggcgaccgtttcctggccggtcac ctcgaaggtgtgtagctcctgggcgcggacaaagagctgcatattggcgactgaacggcg gtcccagctaccgcgaagatggagtcgagaaagaggaa |
>HSFAU X65923.1 H.sapiens fau mRNA tctttctcgactccatcttcg |
>HSFAU X65923.1 H.sapiens fau mRNA tctttctcgactccatcttcgcggtagctgggaccgccgttcagtcgccaatatgcagct ctttgtccgcgcccaggagctacacaccttcgaggtgaccggccaggaaacggtcgccca gatcaaggctcatgtagcctcactggagggcattgccccggaagatcaagtcgtgctcct ggcaggcgcgcccctggaggatgaggccactctgggccagtgcggggtggaggccctgac taccctggaagtagcaggccgcatgcttggaggtaaagttcatggttccctggcccgtgc tggaaaagtgagaggtcagactcctaaggtggccaaacaggagaagaagaagaagaagac aggtcgggctaagcggcggatgcagtacaaccggcgctttgtcaacgttgtgcccacctt tggcaagaagaagggccccaatgccaactcttaagtcttttgtaattctggctttctcta ataaaaaagccacttagttcagtcaaaaaa |
seqret is often one of the first programs taught in EMBOSS training courses. This is because it is versatile, it is extremely powerful for its size (17 lines of code) it illustrates many aspects of EMBOSS programs and it was one of the first EMBOSS programs to be written, so it has a special place in the hearts of EMBOSS developers.
The name 'seqret' derives both from its function ("sequence return") and from the fact that immense amounts of functionality can come from so few lines of source code - most of the work is done by the EMBOSS libraries which the program calls and whose complexity is hidden, or "secret".
Program name | Description |
---|---|
biosed | Replace or delete sequence sections |
cutseq | Removes a specified section from a sequence |
degapseq | Removes gap characters from sequences |
descseq | Alter the name or description of a sequence |
entret | Reads and writes (returns) flatfile entries |
extractfeat | Extract features from a sequence |
extractseq | Extract regions from a sequence |
listor | Writes a list file of the logical OR of two sets of sequences |
maskfeat | Mask off features of a sequence |
maskseq | Mask off regions of a sequence |
newseq | Type in a short new sequence |
noreturn | Removes carriage return from ASCII files |
notseq | Excludes a set of sequences and writes out the remaining ones |
nthseq | Writes one sequence from a multiple set of sequences |
pasteseq | Insert one sequence into another |
revseq | Reverse and complement a sequence |
seqretsplit | Reads and writes (returns) sequences in individual files |
skipseq | Reads and writes (returns) sequences, skipping the first few |
splitter | Split a sequence into (overlapping) smaller sequences |
trimest | Trim poly-A tails off EST sequences |
trimseq | Trim ambiguous bits off the ends of sequences |
union | Reads sequence fragments and builds one sequence |
vectorstrip | Strips out DNA between a pair of vector sequences |
yank | Reads a sequence range, appends the full USA to a list file |
Valid names of the databases set up in your local implementation of EMBOSS can be seen by using the program 'showdb'.
>AF102796 AF102796 Homo sapiens alphaE-catenin (CTNNA1) gene, exon 11.
There are many "FASTA formats". EMBOSS uses the format that ACEDB and the EBI genome projects use. The first field after the ID is the accession number, so that accession numbers can be kept when sequences are converted to FASTA format, without using the NCBI format (with '|' characters in the IDs).
Your EMBL format file has IDs that look like accession numbers, so EMBOSS fills in the accession number for each sequence, and reports it in the FASTA format.