Ȏмظ11"t €u6Uu|agPtPS[X!Using drive X, partition YMBR on floppy or old BIOS Read error No O/S No active partition Ox ??C}?@B}U?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~     123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`bcdefghijklmnopqrstuvwxyz{|}~      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~                           ! " # $ % & ' ( ) * + , - . / 0 1 2 3 4 5 6 7 8 9 : ; < = > ? @ A B C D E F G H I J K L M N O P Q R S T U V W X Y Z [ \ ] ^ _ ` a b c d e f g h i j k l m n o p q r s t u v w x y z { | } ~                            ! " # $ % & ' ( ) * + , - . / 0 1 2 3 4 5 6 7 8 9 : ; < = > ? @ A B C D E F G H I J K L M N O P Q R S T U V W X Y Z [ \ ] ^ _ ` a b c d e f g h i j k l m n o p q r s t u v w x y z { | } ~  0      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~   !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijwxyz{|}~      !"#$%&'()*+,-./123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~     a      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKghijklmnopqrstuvwxyz{|}~       !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~     123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`bcdefghijklmnopqrstuvwxyz{|}~      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~                           ! " # $ % & ' ( ) * + , - . / 0 1 2 3 4 5 6 7 8 9 : ; < = > ? @ A B C D E F G H I J K L M N O P Q R S T U V W X Y Z [ \ ] ^ _ ` a b c d e f g h i j k l m n o p q r s t u v w x y z { | } ~                            ! " # $ % & ' ( ) * + , - . / 0 1 2 3 4 5 6 7 8 9 : ; < = > ? @ A B C D E F G H I J K L M N O P Q R S T U V W X Y Z [ \ ] ^ _ ` a b c d e f g h i j k l m n o p q r s t u v w x y z { | } ~  0      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~   !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijwxyz{|}~      !"#$%&'()*+,-./123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~     a      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKghijklmnopqrstuvwxyz{|}~     BOOT (DhDMLO PhDhDQhD@UENV TXT (QhDhDQhD2U-BOOT IMG 7QhDhDQhDfU-BOOTS RhDhDRhDBSD UMG QShDhDahDo>#" 0c OEQ QA 0>#" 0c O0 @6 -LM 40 \  ?R(00 Sp 0 000 $   0  X 00 00_W00S1 000_W0S 8U  Y y 0  00_Y00SA?E0CS <80^  R@ 0t`  ` p(K x0`  `p`d \ |   0'00_\0Sp Y y  0 l0l't7Wpp@0 ,@8w\0\0hH 0S x P H0S `KH0H0   0PP ^u X0S `0D R X" 0@0 @`0D PH0S\0  LPD0S H  0dH E U 0 \PP 0 R HMP P( TH0`0`O/\ `PX`^  D0"P0@0@0@X`VDP㎬<匬" q u:D L0SPXx H  R @T 0`   Y y   0#00_Y0SP W w ` 0 00@#3UPP` 0 ,@lS~\0y` \0z` lSH  v ^H0S `KH0H0  0 PP Q X0S `0D R X" 0@0 @`0D PH0SV LPD0Sp H  0*H E U 0 dPP 0 [ HP R8 TH0`0`O/\ +`PXp^  D0"P0@0@0@ ᒹ ` \0  H 0XXpWDP+)H0STH0X``0`O/ H Q ` H0SaTH0Xp`0`O/  H 0EeEt`0DP`X M<P D L0SaP_XB@O`0DPpX # X2D0<.X*D(@0`0 R T`0 CR` X0 X0({np0R RXnꔻ H`0 CR` X0 X0p0R RXsn괻u*E-,1M p 0R  ``XRxR `R,! B00BP@ S0A Vr 0D A0a00c BR,! 00BP@0jC R17 1RЍ.R0X r 0t -pa`LP @*`P` 0`!P0i5V1P Uj!0\1 X -LMßß8 < 4 =@0 `P j @Ty Pp0 ,P P2@pT&  5P'P2  0R0X0S00s0P  0 20RE P2, @pT, R 2 Rt2 ? (K<0:S  H0P 0p, 2@ YR00S5 1 R <0:S  0S 11   < 0:S:? 0R 0R RRd1 R < 0:S Pd ᰷o0BS-R @0S0 R 0 00 R0 R <0:S @0S 00   0<0C0 :R:?Q l0 R48L 10  4 0L0gȬجĬ̬4+ -LMR4 , 0 80  F0S0000s %0S40 -R 0S+R 5 0R0%0C00%5  huPu` X@t  00  e00b 0 000%0S0 R#, `4V ^0 4A@-QPpU4嗶P @t $0s`U p$-Up 80Sc T 01S\ -Q W :Qs 4tPn 048 0mpPF 3#040P -Rt44 u+Rr44 n-U30S5P(KPsP3PLu0 0 @00#@d00d00P00"0P@0Ђ0s02`p@P:U@30S0002 R 40:S |t2P?P0Su0r0"P,2u a  000 d0b01 r-U0S4ܵP 8 0R0WU0S0 0;S7 :S 0S000|H00 R@!0:S 0, 0R0 1! 1Q  40:S 0P40 :R:P?PV0 100 0 0L0S0,0Q0 |0l  Q 4 0:S010048 0yP Ȭܬ++ԬЬج wĬ̬ -LM@@ZK -LM@@OK -LM 0D K9*75*7CC0*,*$$(*6$*6PP**33*##*- 0L0 0 0 0 0 0 0 0 0 0 0 0 0 0 0  0\0 * -`L pPIwPܴP 0Q @Q ϴPX ȴP @TP k@ - L0 0P̽+ -pL P@ 8`P0SX 噴P @TP k@ - L0 0Pܽ+ 0-PLP {k00@צ@@Ӧ @@0+ -LM0PS ,Ki@P ,Q 0#S S 0i@P $K0 S RA,  #xwP0d,0 ,ت`P , U,0pp&*P @p0 S S0 S S *`P 00(K (0S ?R0SP("(04"48@#80 @PB `8)P7 @00T2 P.@)P( 00@T# P P P@ 0@!0SqP 000  b `llhP0^q0 0n PK@.G @_기\L` -L70P+ 0-0LS@P ' 00 00h 00 00L`+ 0-LM@KPIdPPPQ R 0S0S *.d@@8(dP@@8 --L]MqPM?KC/`KK `1 4Q 0Q @0 K 0KQP   0 K|1 1 8 Mp@ 1P復P 0RKP u01 00@ 00AiB` --LM00  K 0-@0@LP 00\hT  喘  0h^hid -LM0`0  P@t 0-T^ +T0@,0 ,  v 3V00S 0TS R0㼯p㨯00D S t, (!000& W070 cV \Q00R00S!! ("00@0T  ㈯ pt `,0\00S00aS \0E(K@ , 0XSxS@P `rt0P0A0\A -LM0  pA p-LM @K`P0 ܟKpl --LM0 0 K -L M@KPT KKK 0-L@Pp Pp T U 0㓺0X ᶼp@ -*'T0H@*{{*0(0 -0LP0 0@-Q@ Q QPP000P0P0 0-@L0PS T00SP0h -LHMP p៩P h㛩`Ph p 0S, R00U@ @@4K돭PPd 04 \ X T `@ YdKTYP0S ᴣᲣ0h0 *0  U@P04,"40ᡣh埣h@ T0T L0S00A0@C$1HXP! h(K 9ZP P00  0@Zp 0000@ 0000d@ 0000p 000@0=p 00}0h 00dl,x -LXMt \ x |0 Q d `0 40h P`0 d K  00Sp 0p0 @l@ ( P 00C,̠Č 0("ČT@L # P_ T0\KPX t0  0PO |x@PH pz!PP pP d `0 h@TB 0A嬡P0LPK0<0 8 "XpKP XP(P (KX0Y(X(P( l00Csl0 t@  0 P(d@`@h  R p (0S0(0-!(0(00(0t 0P0 (0,  H0S 0P0vX( P(0S0(0\, -RLp`PU `p@`P` 0(0,  -RL,MT P T(K0 @1<K0/L#b00 0@2K 0KhL HK<0SI 8 R P PA$0L00c 2< R{0@8PS B< tpP R $0 00  40 4 0< ph 00X$0J;, P0 $$0 :, $0c ?00$00L00 04>0S 040. S  @PI P,] P0 $$0 :, $0; Pp0( 0 0LiyT ,P 404) D $@ @ < $D T P <0S$$0BP> P 04$0 :, $0=,(Ko: P 00T R0,0 - P὞P0 P0P X0SP 04 P 0, 0,0 P0 $lJ -`Q00 V@@TLP 00p @$0 D T T P V$0@:$0<0S0 /R $0` P ǶpPP0,L 0-0LSP@ 00T@1S00 -`LVp$0*-0Q4X Q$( R> 0`VR "<0Se 4S S 0$  0R/S@/00(  Lvx`$0  `$ 0B8S P$0 SP 404Q $@O 4 0RK 4P %04P͝<0s 0$ `<QC$0 0`S004P$0@wP( L$  x/7>P XW @ካP x(P04 00 `\P  % :$00P| `e44 $0 ;PX L =P6 04N 0P 4 04 P 0  Q %nM0S  0tP} $0P:$0Pt $0 ᒵP 404$0`:$0!U ``Q @ M @$0P:$0F 0 $0@ 0 $0LlJ -0LM@p` / 00 00(K(ʠPP0P  0P `00$@0 0$0 P 08xvS <  vS x vS x@@<@TU wSrwS?A vS]\vS]vS]h DHpAvS;zvS;zvSCtycAvSj"vS>~vS>~X fnAvS(vSrQ3vSvKy:{K(VAvS*,vSvS| AvS¶2vS+}7vSvKy:}wAvS~vS~vSg~-vSq2vS&vS&` Z u!vSmvSmvSm2!vSmvSmvSmN#9f!vSIxvSIxvS]z:v!vSIxvSIxvS,!vSIxvSIxvSIxi*!vSIxvSIxvSIx W-B!vSvSvSo!vSvSvSg~\w!vSvSvSA!vS,vS,vSn }r!vS,vS,vS,U!vS,vS,vS,pavS,vS,vS+K!vSAvSAvS+avSAvSAvS+6}!vSAvSAvS+AavSvSvS+wo!vSvSvS++~avSvSvS+ǐ!vSvSvS+&}avSzsvSzsvS+2!vSzsvSzsvS+( avSzsvSzsvS+˭U!vSzsvSzsvS+VavSG vSG vS+r=!vSG vSG vS+awavSG vSG vS+!vSXzvSXzvS+@avSXzvSXzvS+;M!vSXzvSXzvS+$avS5=vS5=vS+ k!vS5=vS5=vS+ HavS5=vS5=vS+ Ce~e!vS5=vS5=vS+ Q)avSvSvS+ E!vSvSvS+ 0^avSvSvSA#, !vSvSvSA#, ]avS5nvS5nvSA#, !vS5nvS5nvSA#, ravS5nvS5nvSA#,U!vS5nvS5nvSA#,CavS2yvS2yvSA#,!vS2yvS2yvSA#,DavS2yvS2yvSA#,e!vS2yvS2yvSA#,6EavSvSvSA#,^!vSvSvSA#,&vavSvSvSA#,'!vS7 vS7 vSA#,oavS7 vS7 vSA#,Y6D!vS7 vS7 vSA#,avS7 vS7 vSA#,,!vS% vS% vSA#,ÖǖavS% vS% vSA#,0'!!vS% vS% vSA#,0avS% vS% vSA#,=N!vSvfi!vSvfi!vSA#,avSvfi!vSvfi!vSA#,R\!vSvfi!vSvfi!vSA#,]avS"vS"vSA#,tt!vS"vS"vSA#,avS"vS"vSA#,Q˒!vS"vS"vSA#,KE3avSe"vSe"vSA#,x!vSe"vSe"vSA#,y皴avSe"vSe"vSA#,)KH!vS5!3#vS5!3#vS,\avS5!3#vS5!3#vS,.!vS5!3#vS5!3#vS,avS5!3#vS5!3#vS,8!vSQe#vSQe#vS,<avSQe#vSQe#vS,[b9#!vSQe#vSQe#vS,\JavSQe#vSQe#vS,I!vS d$vS d$vS,avS d$vS d$vS,!vS d$vS d$vS,DavS d$vS d$vS,"L!vSd$vSd$vS,ˀETavSd$vSd$vS,E!vSd$vSd$vS,qB[avS %vS %vS,!vS %vS %vS,xavS %vS %vS,~!vS %vS %vS, avS`-&vS`-&vS, !vS`-&vS`-&vS,+avS`-&vS`-&vS,!vS`-&vS`-&vS,fK]avS&vS&vS,@!vS&vS&vS,bfavS&vS&vS,r {/!vS^'vS^'vS,*JavS^'vS^'vS, !%!!vS^'vS^'vS, &uavS^'vS^'vS, <!vS'vS'vS, ߴ:)avS'vS'vSjAT- (!vS'vS'vSjAT- #?avSpQ(vSpQ(vSjAT- DN!vSpQ(vSpQ(vSjAT- ȏ¼avSpQ(vSpQ(vSjAT- d!vSpQ(vSpQ(vSjAT- D&avSX()vSX()vSjAT-UV!vSX()vSX()vSjAT-:mavSX()vSX()vSjAT-r!vSX()vSX()vSjAT-r_4!vSP)vSP)vSmB !iBu!vSP)vSP)vS&m ԤBuavSP)vSP)vSjAT-5m!vSP)vSP)vSjAT-JnavS. Z*vS. Z*vSjAT-!vS. Z*vS. Z*vSjAT-!vS. Z*vS. Z*vS. Z*?uʣ!vSKP*vSKP*vSKP*?:avSKP*vSKP*vSjAT-?"&!vSKP*vSKP*vSjAT-"avSKP*vSKP*vSjAT-&@!vS +vS +vSjAT- ֎navS +vS +vSjAT-#|!vS +vS +vSjAT-7avSZT-vSZT-vSjAT-@i!vS-vS-vSjAT-X|ݓ!vS-vS-vS-<e!vS-vS-vS-=!vS<.vS<.vS<."&!vSO0vSO0vSO0"m# !vSO0vSO0vSO04hr!vSӂ1vSӂ1vSjAT-föQ!vSD;2vSD;2vSD;2(!vSD;2vSD;2vSD;2(suj!vSD;2vSD;2vSD;2(Zg !vS2vS2vS2(,l+$y(\xIK^zvNg`NF Cs- qcչXoB1@[Ɖ;M {|KzGN&QJQ "q A˽sp(s-k[uܬBy\nu XM]n'D)tV1@D1oA}M}X<v̹AYɤ(9QY/LQWny)!_gـ>_ FHHaD-iEDh?$ PFTXo^que? KGo${%X<&Q=zaeT{4u2,Wu=#jLKȥD^YYtȇ"TZ E^!;*O . ..MAKEDEVconsole  tty  mem kmem`o null`o zero`ostdinostdoutstderrksymsoklog`obpf0`owd0a`orwd0aowd0b`orwd0bowd0caorwd0cowd0daorwd0dowd0eaorwd0eowd0faorwd0fo wd0gao!rwd0go"wd0hao#rwd0ho$wd0iao%rwd0io ... . ..chowndhclientm disklabeldmesgfdiskfsckn fsck_ext2fsfsck_ffsmifconfigminitnmknodmount mount_cd9660K mount_ext2fsK mount_ffs mount_msdos mount_nfsnewfs newfs_msdos newfs_ext2fsKpingnping6reboothaltnroutertsol . .. binmdecsbinshare . .. ftpgrepnfgrepegrepgzipngunzipgzcatlessnmoren sedPsignify . ..misckeymaps ...aPW _PO 0<0@T . AT% ᯪ P5 I@PL 2 0<0 $  P04VY`, @, ,@ ATVX# #P  04$0 X ፜ 00 ᅜ僜ၜ 0 *   մP$00$0L -PL0@S 0` 0]0SXh-0` 0N0S p0S ꔻ p-LlMK@`P 0: S f 0P0KpP P Pl00@0աP  @0@`0@``P 0-L@pP  00R00SPP 0㧷 0 P 00 0-LCp@P PP 00 -L,M, P ,"pT0 0 rpP W ZD oP,@P0PC$@,P(P@Z%,`)T0PcT0P`@DQ,0, 00 ,,嗊(8 H @@ 8@ PTu*Y H,j 0lS0P`S& DQc,X 0\0 0h@dgQ!Q D\a= 0Q0 W:WF*`d,` ,P  P0ZD0 , ) R@100*, Tg`g $ 00 `, 0R*@PT0PDP DQj 0P0 `, 0R:  0gY@(K,T0Pg`g " 00 g `0S @t:,T P0D\ DQI 0\0 DQOH0@8 H 00 HH @@ CDP,Ř 0P0 .DP @08@ 0 0 @gDQ 0Q0 0 0P0 0 0Q0 9 T0,3DQHł 0P0 P,1 T  `,0PL0 T P0i<0 T P T PL0i0c40 T PT PPT0PT PPT PP@0,0, 0P 0 ! 0^0 #,0, 0\ 0 T P`h0H0H 0Q 0 $P, 80)) S@10*,0Tg`g $ 00 `,0Q*@PT PD\ DP 0P0 `,0Q:  0gY@0 0P0 0 0P0 tT P\4T04PPST P(,T0,`P`T P)<T0<@P@ 4T 4PP)<T <@P@ ,T ,`P` p-00` LP0\00\ P! " @!R 000lR  0  00@pf 00p 0-LM.00La L Q A0LRW0LQ70LT0X\x\@@0 -Lp= @P@d㴜P`d 0@:SS   P0Pfd#P `d P@f P` D`V ϖ -Lp= E@P@dzP`dP 0:SSo ^S \S0@ PUPfdPl `dP0S:SX 00@\:\O 0L0S 0/R@ 7R 0 B1/P07P0 @10@0B0L@2SDܺкĺܺкĺ00U@f {P`VD`0T0 00} 00z 00w:00t00q 00n00k -8@LP Z000 0蜿 0-@PLpPPd0@@0ޣLP00⩛40P (0@ @墡00蔿 -MLM@d  ^, ` h8 l p( @0S`WP lmPm  vP 0pS LH T hL(Q\(  h =T80T8 X 傎KHH`YP 0 S 0Z@PY+h8SYP `0 SU0U@E\S 00 HX #RR l#Pp^ 0:SP P0:S0@0pP@ P( = @Pr P0S :SP:0C0EK0@ @A\(h8@c`P vV v:0P E0E 4 0S :S00i c 00 4  S`D:R:0 00H0f c a0 X0;0g@MP H0g gg0 0H( `pPH @ ejo40(fo HDH ;Pg)P: 0g@pPPX(RhYH8dg S0A0:P`@^@pß, 0R(K3 Rfh(02@X8S\T 0h8 0L0SL ᷔT(R@@WX\K@ 00BNK@D@D"ˡ P)*2 R% h 0rP l^K< uPE@8 PE @D 0 p& P$ D0Sh@8 0C<( 88 L @WPh TT X hYhV@hX@ 00TT a 0P  p000\H H8 X Ph Hf0X\!3@Z0@WW+X(R2 &Z@ 00JZPp@Wn k@D Q? `P0`?SP``L0@p go@pb@ {?0YP@p s?0Y@P0 -L M⼀0`P$0 ,pK  !62 b1 R<0Q0^ph ~?@ Q R $ 0R K *%i  0-LP@ 1  !1P\ 0hG<<d*- 0BSR0S񟗹t?Q00 000000\Q0000 0AlS񟗠P`````````````````````````P````````````````````````````````````````````p```t```\```````D```,`-Q00f ^Q,00` 000Y0A0S0Е 100ࠓࠃ00 K0A0 S 0Еࠃ10ࠓ0?00;007003\0 0 -0 0 '0 0 !0 A0 0000 0 0  0 0 0 0  0 0 0 0 0 0 0 0 0 0 -LM pK00'`P@T  0P 00P@PT 0PPh@ -0LRM 0 `pC CP)K0K@T  0PW0#3#0%(KU)0[505PW)0[0Ņ@PT  0wP U0h0ŕW)0[0ŅPcc*( *=*=UU* 0Q0   -RLMPpkܑ0SaVU0 P @0P 0000 R r0 11@```CNX@' ,K0 KUW@,p. Z, ,0WKX@0@p0  g00 p0S&4V(K,0W`'0C0 0 00S ZဌP` Z@徆HH?R0S` pf`ꔻ\-  S 0S@nhh*$%%* p-LMa0PS-@T 0S00S @ R0S)xT! 00@0SK`K pP 0S [xD Tx( @00 ꔻ̿ p-LM, 0( rSwS@T l0@0Kp  0S $K⩜P2 RRpPB P#1@T 0@T 1 R T, 0rSU $P[(0!3d1 R6, 0rS8 , K@$0(a@ P0S00  0 R$ @хu Pq  000Q0 g d a $`K@  @$T $z埅iꔻ̿@Eĺ -0L IP$ -BML Mß0P,0 T$  0S 00ß, 0R(K/PP0P4 L 04  T$L 00C=S h     R  1!S  b-1A L401!0>T$忾BNK@D@DP  p0 SP&1KH4 1D A  @d < 84 4 廟X^I`P 0SDa ɒBNK@D@DPQ 00UBNK@D@D (0K@/04L  (K 04BP0S<8Α0@P@ᛒ00 c-!!R0$ 0  BKA@@DAPT L 4 00iE@DPHeLLw\3$0 P$ -0-LMP0 S  @     0S0! b-1 00   0S0 0  Q 0RK0x ~ 00i, --LM@0 S       0S0! b-1! 00   0S0   0S000 Ľ 0RK1 7 00i4 -0-LMP0 S  @     0S0! b-1! 00   0S0 0  QL0 | 0RK0 00iP$<0m --LM0  0 v K  0-LM@Pq;PK0 J=P ;P   ;P $@ 0@P -LRp` @PU  PP@ -L@pP:P `V0S p VU Vp @0pP00@V00S P0S-00@T TpV ׈PP  } 0Ppdd` `      P0 p-LMP` P P |P0l `0 0 Kp@ 4P0( @@l,п -Lhd -L  hE|d 0-LM0@ K Q0!ŏp@\ Pڔ!廏|K0@\` 0S-       8           0!噏pP, P 0 ሏpP0  {p0 P0 R@` p01S ` gpT0< ^pTпpc0$|LX -Lrhd p-LM P|` 0 S 0K,0 ( $ 0 R r 1S0C1,K'O0@SKpꔻ -LIM0 P$0  0SQKO_K`NK@D y @ gl0! 螜$ 0R  KD! 寏,0 MoKK_KQK@ <1 8! iT@-0 S 0Q S0 Q(,0^ 0a(00 0Q<@\ 0-L 0Q0l0CP< (4"4!<0 @@b T 0 0 0@-Q @0S 00@  0S* n B!< 4!4"<0 0 0  0- @P  0SL 0  <4("4!<000 0P 0 0 0-@0LS@ 0, $ 0 P bp 0,0(P0 p-PQL@U  0(0PbU (,0`SPppcP0à - @LDP`Up$P  bLP"W000H$P1 H04 X0T  cP@ X0T PX> 00࠱PP L0 R0L00P ࠑ0H<,$!$ H \ QT0PR<0TPU$фP $(0lH0 (0, P$8`P, 6<PP$, 0 @0 X 0,`H 00`(40L P,0 D P @ T ``0 (KoK @08Ko~ 0K~o~꼭Hd 0- @LP 0㘚p 0S S 0 00b0q( ,00bc0 p-L@` Pp 0fS  0 `P0P3 5: pS0( P,0 `R$0R0` #00%( %*P 00 -(0LSP< 0S2L0 ! P` 00/`VpP <0O`Vp0S R 00cO`p 0(p`p 0q 00`p0ꔻ -LQz W00 p - L@<0 R0`00^00X00蔻 0-HPL0@S0`0000`00 R 0hꔻ -LMPD \l (Q  &0SfXF X X7 `p@R, 50 S g5QR ;0LPK0@p 0P @0P }0000 0@8 0@0S E0S0 0(KK0  P` 0S  0bO`p0K0@0 @ @/08CJK0P0: S0@ ;L 0XoKT  P`0 0`VpS < 0O `Vp08  c0 0@P@ 60# Q0`ʜ ` 0@0@ Tmj L00cO` p  0@p 0@0P @0P (}0@0@Y 00Ÿ0Sd  j00/`VpP <0 O`Vpr XKⰹP&PK K q* Ÿ0SK D X00SG <@0@ 0 @p`p" 04g# S@ 0` c00 P @0P |000 0D0 R Kq0S @ Pa_7 00   a0@ P0 Bq_ 0@p`pq AP T0 d00 S0 00xU0/`P  0S SL ߵ* -2MLMx$@0TP,0  |<S   0/Sk @P B.K B B, + w X030#` V0#ScVH < VD / 嬉P< PP#@aTQ~KpGpG ɇ(K0YC`d   mV,@B0 /S (3X5/00,8[S 剉P 儉PP0XP /o,0VbPX A0/S/0C0@0@0S^\, 0 Rz(K?00,R,  {0<  +TrPK AìPPh<: S Qk®KJJ  ἖pP( K`\F,<[/SD XP /P0aY 00qiLlJh 0-@P00QPLTP x p 0K@00 ɀP @P{@*||* --LM0 0 b K 0-L M0KK 0PSH(P(@(8((P(H(,(@ AK0 "000@@@ 0$0%K -LM< |<0D @  Pu 0-U +U 0P8 80 D@ t 3T00S 0U RUD0 ?4 00 8 RX 4 K 4 K `V0D0@`c`f,` `p 0E Qࠑ uz \B000t W070cDPmR8Q4 YNK V0_ , ^00SD041 ,/@`p`Vp P0U8  @@RD@ 4 0 4 K g4 K , 㖇 W# 8 V0& ,@^00S0040 ` `Pp XH"00P`q V>"00P`q W0 W0@Q RJ< <0@ 0(KP8 ?0XSxSEP D 4 0 Ct -L@)T`p@P  @00#:k0cS:UV@ 0'p`p -LxM`OP0 U80   0@D0 @@ 4 40 -SX.d.d.d.d.d.d.d.d.00000d.d.d.d.d.d.d.d.d.d.d.d.d.d.d.d.d.d.0d.d.d.d.d.d.d.d.d.d.0d.D0p@`PM  | EPeP Y|0x@0`V ptp 4 @T400t`VDK(K@0D`t` 00Spxp | /Q9Qp@`9Qʇ!000T0pCچ!000T0`C@4 /QP R 0S J0SG0 RT4 | t 0@ Q  |040|0 R" |0S  P 0BSpچ0R`|PU 0A R;ʇ!00 p0|0 04 0t0 4 0Sn 00Spxp 0XS xS 04 00S S_  x r4 @t@ |x 0 N 44 0+Q -Q,A    00@ S4 20P404 0P 10@S%40P@p p 4 /P 04 0@!00/PP9PpL*0aUS RaY T @l@ P - Z@PD@ @P D:H A n@P 03mD @ YQP` 0j@T 9 DKnD @ 07 MSp`p dp \p Xp )0@ D0 `\ 8W'dU'\S'`Q'XO'M"00 4 s%P}P`  fsPx8L d8 0R$P` d \ X  X \ ` <'Pd `0  ! ▃DK, K00Ko'P8 (P\ P@, TP`PPf00ࠡ࠱Rbp t B gR 6cT PbP @0"00C`T0 T @0` @T00 S 0S p pc@c`cU \(P\ c 8(PP_ 8&8P T8'P8 T Xd(Pd L Vd'Pd D W\'P\ < d8E'PX 6 0 0\@&PK X\# 1@P%PKYe u` l h @5 Z 0Q0jZ0S lKx%x5u%P lKP l h Y l0K`pk6pjDKt 0m 0DKlD @ P@`\050Zp 8@&d>&\<&X:& 4cml h Ylph@@PQ\ P`p 4k`p@D0SH@ 46SE 3%PA44 7ml h l`A0`p | ]I0@%Sf:....:..........................:....:S@  2r` l h0 I0P|@  |@ 04 |00P0|0 10@S 4|0@ | w\2 l h0 BCbVD@K0@1 ` l@PVD@ @P @05&C@ ! DKlD @ @"1 R6CR0!0 5&0C@@ D0 @ @ ?4@K#"P 40 (R D @ 4@KL"P 40C44 "P40\!04 @ D0 Qt80K4K< K0S@t 4  S S 8 RL`K L`K!8-%0DK< XPP\ ~\cʄ0 DKFlD @ N?A|0 |?5?55tP9?5&HDK@PD`K@ ` p  0l 0DKjD @ @h0 0S56@0 0pW @0 0D0 lKdje 0lKljY@PD0S46S !(1#Pu8$d$\$`$X$h!h1#P|!p1"P\l`hp0A;h@d 1 DKVjD @ DBZ T30j0T0 DPK`2 @ kP`TDP @` `V @820#:kcQ Q4Q0 AD0 0"7&@ @ DK 0a P&p`p dp \p Xp 0@D0 @@ Ry|nY| @#46S TpW  Y DKD@K0 0iD @ 8&$d$$\"$` $X$Q #0 0 K DKAkD @ 3@ 0S}YD0S@ 46S30kSX 0S0SX$0PX0 \#P@ ڌ`V L40kS7S8#d#\#`#X#Y0ц!0М `0| |0 տD0l0 h@ D0@ 46SD0SPiP0Q; E DKjP e jD @ D0y jP0s$|DKL `iD @ DKD@K0} 0/i @P0D@ @P P2 XL K!PH0$L0&@ D0 @DT (60jS#:k0c&B# P)X6Q `60&0@ D0 2|606C#**0@ D0 )D0 1D0 p 0-P0@LS CDCC|CDCC000 0100."000 00 1 000 0  010000 00100C.0 6:0 0100 -RtL$M@K@P`p0D 0@ K,@K$0K4P @P$ 0 K  T00 5CS0cC*R7S0BS c020 -LM< p ?4 00 ڃ4 K O, P` 00D S t= 0007 W070c Z1R V" U0& , \00S0040 Po P` @0T   04 0 UX"00@P` V080R00S Pu`@Q RpG <2 R] 00SV0 R r 1S0C10B <000PD `0S@0PL vpP- @ u~0 @p000CC000 R0@ <08 000B 0C B0S %@P, 0S0$0 0R0 R*0\SL ,xP 00π0;0B #A03@ #000000@-@$ 0@0 0 0 #EgvT2ܺ -L@M@ hK} ph( 0 @ 00# d ,0*0 0#`a0"00# \@dȟ0! 00#X@Dlŀ0 0 0#T@$(0, 00# P@ b* 0.0 0#L@0"00# H@ǟ`0! 00#D@̀0 0 0#@0n)+C0,0O B0#  <`G' 0.@0 0#@8@@dE0"00# 4 0$00#0`ǟ` 0! 00#, ǀ0 0 0#nd@& 0. 0 0#  -P@0" 00#<@|0!00# ` h@\Ɵ0 00#lƀT@<0,00#@@& 0. 0 0#  +,@0" 00#aX@0!00# `D@ş0 00#̀0,00#\@% 0. 0 0#  b)H`E0"@ 00#@@dF4@0$00# ` ş0! 00#ˁL0,00#n$ P.0 0#  T0b&P"H@`0"0# ğ<0 0 0#lȁ0! 0#d@d$0, 0#  HX0b. 0.0#L@, 0"0# ğ@0a 0 0#4@ā0! 0##h0n 0,0#\@  * 0.0#P0`0"0#D@ ß0 0#ll΁0! 0#P#,0 0,0#`@ 4 b( 0.0#h@000# L@Ÿa0 00#lˁ000#T@"0 0 0#  % 000#\@|` 000# @@\Ÿa0 00#d@<ȁ000#H@"0 0 0#  ,Ab- 0@00#@@PQdK0P00# PP4aX0`00#``Xe000#<|` 0 00#` \lˀ000#D@? A10N@b@P, P0@ R?W@pG 0 _?W@P0 W(K (KoQ{@, M{ I,0!pc?WP -L(M< 1>?0@0c@ S80 D ,;8#8?C0C0V`p Vpp@P 0C P00@PP00T0#S 00@ P00T0#""S T % * 00@ T46"*C2&b& :460V0+ Vp0pS0Z0p0GT0  AT,K 1c, ( 0 #2>;8#8Hat.t>bp.p>Ta@ P7\\.\>b 0Ha@Pw[ 0P-\ࠃ|  >  P0L࠳|0 | 0jS SaB0Ct U U Et0 E\t t p   Q00 @  x !Ps \00S ^$-01NB0H D    ̟ `0`p@0 T P< HKP PbH D  @H K `X T |^ XK4< P00Q00S ROXK; )b0X T 0L0 8 4  K b; `40@S UA ;XK` 0`pP 1P ` \   pd \`0S d\\`h 0S00 p` p00S  0?o \00Ӏ!  \ `: a 0P ` \ p100 d Q @ B¤ Ť0@Sbbg gff x x 0Z J∠ ӄ 删  x 0S00 0 0 x x ,00 0C Q 0A63@ a 0aCA~J Al  4 8 Dx\@` 0tS\t0tS0ct @cc Rx0S ` P` [ hQPPW hhP P\ O pQxP R00Sp Vn46Sj70Sf t0@0t0 p\0\t00t 0 t @Tt0S|\6 R`U XY` ` @P `0  ! KvP `` pd ` ` L <haP Q U00S 0S X^00S \W UbL 0`R h  HPh d`\u d  =Pd `  6P` LL \hdh `\@P 00`S gP Q  0 cc p Y0 _P00C0 x\ 4@5 ( _ 0^@ < XK$Y@Y 0XK^0@ pP`@@K 0(P< 0^ 0@KPv4Q i^@ K %4 P 0jW_ @K 049` $4@ < 2``PX@Y 0^0@@@ K `PP 08 ,P0@ pP0 `@P 0^X`uY 0` 0t^000 0@PP 3 P\P  0p^@P  0P  0P 8  w9R W8008  000800 hPh 40 820_  XKgX`Y 0XK^ 0@P~PP 400 p\00W 1_P@GX`X 0] 0P@^4P00 000 <1K] 0TP K ] 07P0w0S 8p t408`0 \0 @nT/X T   ` 0cS0Ct @4S2+  P` S d '?aCoc?`(?yPD??$@@@?0  _Db 0@P0 pH0 p _@P `X@ TP p@Ph  \h0`h`h0  \0Sڈ T@d hPh \_P0w9S{ W p100  h\NPh  QPh UvN  \010! 0`l^,0CN@6@c+P` t @t E0SS\ %P\ \h\PʔUP\ W\TP\ xzhLPh mr`DP` rjh0S0SU%`qd o9V00k90000ez0w0S p] X T p`  P` ;h Ph U \P `:V `>9V X1``8`3 -LCUp3 -L0S@  ?0< B<R0LA0 0!88S@  ::S T0 0@ -L@\`n0P0Q`  RP \  P p|3U 1R 0 S 0 S?0 ^^/0nP  VPPP8PT00p0 P 0S 0Sp0CP 0Sp0CPp0　PXH06+@P00 R ! 3R$0P VPP  -LPp SR 0S40S1`T000` 00R` 0SJ0S`@S @Z`0 d 0Fp> p P` P@ 0 0R @`ZWP0  d 0%p p P @`ZW0P  0 0`` -LM`P4 8  n0P0(KZA 8\S00P0P 3 P S0M 80P SV#4pe00 0@SW p@40 0P00,K@p,K W:o 0 40 0008 RP P @Q 80@TP 4 0Q,K ZpP4 0 0-0LPM@ dK P6@Kp zo 0<K <0 i0 dKl0 HKD0 @0 H0 帄yi -@Lt 0 0  -LpM؀0 s`$ Q $ 0R' Kj@PK pph K@KpK^ Ηp@pD@ "p  0siP( P-RL@  ?  000 -- LM 0  L K -ML M@H,  P, PL, H$\4#0$@K$K0 S2`, 0R(KDD 0KN@N0($P -p4HPP,Qk`p H<VF``p  @ R@ 0# pVF ``p0S V`FV:000C0`F RBKII ! BKII KT @D R %RP0mSL %S00T0S0 @D P R@@ L<4V 0FP `aC0S: P 0'P`pm 0j ( zpPdP > pPPKn@1AlA 8 4< <\ 0L 9}?NH^6 D 0!oPD@`P  0@,`0a0cK8< 00< @<AA 4 << }ꊔ0!doVF``pY 0 S0GQ D<SoZ07SNK@Dp@D p 00@ ~NK@Dp@DgP 0&PP907S w8+i\``(iD8 0-LM@00 P?P8 -@L w -L@TP`pJ 0 T0#03/70! "]W8?XQd@@0 1T  R#*0B0L!000c00R0nT-0 0@ L 1Z \W@ <"@ 0-LMP40@ L0 @K0P -LM`p@P0PP@0  pt@~TPPK萻P p-L@ P  c3a d 0 0 p-Lpd ` <4("4!<SVJ@L@TP0? " !BP <4("4!<0cS ,  < @4( "4 ,\,.<4("4A$<U@%LPU!0? " !Bp <4("4!< 0cS<,$ 00 q 0 @ @p@ 0+Q> -Q  9 00@ S@p 0P@0@ 0P 10@S@0P@ 0@ /P 0@ 0@!00/PP9Pڌ*0aUS RaD040 @p 1 @ l 0\ P0`40  P  p3 Y ppT @@ bp W@PP@ LP 9H A R@PPp 0hQP L 5RYO\0So \\NP 89R QH  HK 5@`\L9 PKR@P L 5T@@4K 0PK@@@P 40S D0XS xS 0@ 00S S  @ @KD0K@P4 { PD @p \ 0g@T 48 PK}RP L 0 PK< K80K PD W 80<@cT< <8 <  0 @n0TlT @  07  0CP| + |2 P $ |0  ! gD0% P  D  ! g8P<@ Px  \i\\ pnp  0@Pc@0 d0^0j00n`PU00S0ScPc`c\ x Px   @P  @ iQڄ P  Wڀ P  Vڀ P  Xx Px  F Pt  0St0@ p @x= P00\``V 0 03 0 4  W !0@ 40 X T 倔 <\` 8,  , K00K pP| ,QZ pPu D`R, 010 D PD e 0@S20@DT@ T D9 PD R <0C< 5 A 0 D? PD = 0 0CSv R 80@0T80   Q6` <08 @ STQu "2 ,Q @P2XKO 1`p P 0P[ 0@O 0XKPO40040 Q80 @cT D PD < d< 0  x | t @<0 R 00SO SI S D 00 @021T0D 40 * 00Q   0 b320PW   x t lP tx 1@P~PW 0` 0 ` p 0^0Z0S0   R 0S N?V瞯<A?00S0 RT@   0 @ R0 0 @ Q" R  P 0BSچ0R`Ф0PU 0C R.ʈ!00 0@ D@Tj0DPD0C< @8 PD =Pgb_P` g UPg20S60P40 Y RD0SR@ 0 SJ @DTʳ 2OW @@"2@ P H 6I@P  06NX T ^ ^ ^ 3P 0 00c 0 I@P@@  CbVڈ3@ h d L 46 56,ʠL0 LLPKh K @O`FVP L L0# "*/B B V L pP@K0D4 ` cO@PVpP@ LP XK 0$P40 040 G0P@  @ 0@ 00P00 10@S @0@  ` X T ` @@KDP 0 40 0@ 0(S@@  000 Rc 0SD40 0R  04  @040 "00D@@KP @0C@ |P@0@ 0 40 D0 4 "00@`-A0=@P9U}R@d 6 PK[MP L 0D CbV6@ p l L 46 56,ʠL0 LLPKp K @N`FVP L L0t' "*/B B V L pP@K07 p` N@PVD<0 < *a P@jD2PD K <0d8 < A0@PU <ZD0P 4 "00D\  PbU,D P80D 8  \< ! 0\D0D 0@@P040 Pw XK 0PfoQl.aN* Y!ц00 `Ф Ť W!0040 W R 8D210 R*0s  R*0 s 040 @ T00\0SD0 W {PD 08@100@ @d@P80!08 40 W040 !0Z40 ʘ\00P0SttPt x"P040 ŗژPv <0Db< 8 w^\ 80C 8 ?Pi\0\K PKyM\e sMP L 0PK4K 0PKD00 P0< 40 RZ!040 s4  4 4 1L0HK6H0 @`y\|\PKL K 0 1SN  @ 0CD0  !08 < 40 D!040  R0S0 DdRQ8 eDIZ |040 qD08  -L0<0ጽ 0-@PL0 D@0 -LMIPU8 < @0  00SU @  00R@`0`@ `0R 0S)\ 0 \,0 0p00  70S30 R 0S0 0R@@ 0R 00s03p`00 0 00 p8`pQ  0S\P P0`10c , ,0  PR pR 4  V0G000S@Z)0g0CS  0SRP/ 0S  0S W @!`#*`P @ |0S ` Q` `00a W:`@iDA@80BP`Q @a P ,00d,0 8 p0, R80, R@I,0`cU-8  0S; S S- P@"00F R0 0S 0S0 R@0Sc  0S@[W@FpT p2 02 p 80Pf0@,0 W 8  0S S S @@0,0< 0(K0+S- -S 04 40 ) Q! Q 4AP P\ 0>!0L0P40, Sa ,  4 0C000 0Cp,0 p,0 @000 @e P D21 0 " \  Pppp ,  , 8 0, R2 @"00 0,0 4 R 8  0S S2 R/ %P000.@r`bxZPPPF b PP>W 00S `P T@ 0VP @F R 000@0b@8 0< 0"00:1 0W 0eP %8 0,  R, @"0S@ 0bVUE P0S 8 00CS"@21 0 02@"@8  0S: S4 Sh 8 0`BPP0 0@0Pr TP0 0Q0 0U f R!10 8 @0< 00S{J R20S. ,0\  0@RZR R 000A10  R*0\0Q00Q- 2R  101.Q  10 P *0 BSP*02SP: -LM@(KPp`,K0( c,0 c R0b::p  0H$K -L` B/ bR@pP00RP 0 WP0 0@ P VU  0 B_PP P 0 BV0PP0 U @980"p@-R`1Q0@  0 ^2$ Pd050 ^2$R  0fC1S00p^0^0 0fC1S00p -LM0 10R@# *P0@ @0S Q @K0 @0S" 0      $ ( ) * + , !-" . # /D0S 80 00 00 ᘻ$0-@P 00@ b@-A d0.3Ġ Q -LM4 4@00S 0"! 000 004 APP@Q Q00S p ,  QP- 2`VM Qn,X W0#03R0ST WՕ@ `' , P@ Q0Q0XSxS0 S@QPX\ W0#03R0SgZ1* 0Y0*00Y*0S  Z QZO 0AS (K R WՕ@00' 020@ 8 _800S 0 `0320)QX00S400Q" 0R )RP  R0'O0 XSxSa0 S҅@\00 &Z*4 00,0S  0 S  -4@L,    h,$| -L?` -Lw?` -0 `R0`LP: 0P10p@ 8!#800"( (!( 0( W"H0 0b1 P 0("( #8!80 P#HT 0Q 10  @P  ! ]  0"1008#8S"("$"""!   88S00000P 00-0 S 10 0 B\AP: Sࠓ -0L100`p@PC 0` P0 `6<W05#3̠10W#55 P 256U b>003<0S00S0 0-@PL  QXP0SL 10A00hP4[(10 AR 0hQꔻT -pL0PS U AT01 0S0 003 U e10E0C05 `0  C>@0C!0 B@`@ K$KP(0$  `!30$0 0(0 (0S@@0@ -LP`pP@ 0`PhP5 p0!1 0 P`0@ Q Q @P` XP` P *0 @0S@P`YP`00S 0pGS B p -P0 0p -0 0BPU`Lpڂ UP# T  0R010C 0@10 d 040 \2.R P0E00\00\0 -LMD PpU0D0 D 0Pp0 RD0< P@ O < 100Q80 * 0080S10000 !PD0  4 "*, 0S D ,pP`5 J$40  Sp 0 R,00,0 < R 8 0S 0 BS<00S<0 <0@ 0@(K -@Lp P00@ -LM0 0pǏ,0 ɯ0@*"P,` QPp 0, 0R ,0 10p00  0(K<PP0P  00  ! Z0 0P 0-L@ODa TAPU/ ` @T P /@P/ `p0S S@T 0S LPP@ 00p0S |9PU 0S \2LgPP 00, 10 eP|q -tpLpBi0S \h=iTPT@]n`00@XPC/00[UEO000\lL -X1L R/ HiDQ SZ RX@J0S i00 D0 HC/[PUhS`P@0@7~ 0PPlX Y00P100X@C/_[TV h$ 0``@0Gȼ - L,M`o<0N00Kp 0 @rK @tPP 0@ < 8 4p * K@0 @0K P2[Sh0  00p〉00[(K,000l,040 -0L@0 -A0Q (0 (0  0 0  M-LDM@ 0SPl r   p0`lRPPlP h00`08K㈥0S  0FP*MH04,"401(000@0 (0,@0 d`\pV`0h `0 \ X d` @@ `0+hKP D0X 0S`+0l0P (K 0@ 0000lL@ 00 00 |0|@| 00l00 @,@ ~ P0, K `@ 0ؼdl,~f M0-LM@,PP0 PDK0`" 0-@L0PS D00S@L0hL[ -LME Pp , 0  | 0  ' (0 @P @ DKH0 P 0@0XD0`0K00D P 0  0P  @P D0P P ` 0fP 0S6 @KD4@ PTKP jO$$ QNa HK　P&$00K3 P0= @@ @Q Y0ʗ 0S 040\S, 0R(KP p$ <`Kh@@PK0@0 d 0C`P_PF0S 0#S 0 8 404[ n 000S`K`PK`T0KXL PU`QQJd2 K P0= @@ @Q6 Y0  0S  uX0Po`0h QjxPK 0@KPP[ 44P? Q 0  0 P2 @@D@  RPP00Xe0c0=@P` ꄸ 00 RR@P00R0 0 t0 8 40N040Ja4FK 0P0 408 0S 0@0K40@xPx@ xP 4@&i\,Mb?B -40LQ < 0(   p-LM@PU% <\ Kp00`K0 @ 0 0(,0<,00S @NP P \,0S \\ 4dS 00  0S S S00   \00 \ 000 S00 0000  00000 0 00 00 000000 0-0 0 0LS@P 0aP <P WP  RP 0hL 0-LP@&P 0S>P0S0h0h0 0-LMP@)P8P 0S 0*8  0-LP@P0 >0h 0-LP@P0 P 0S S 00P 0h-  @ @@-0S@ 0C0@ <(4"4!<0  -0S0C0 <(4"4!<0  0 c0 Q0a0  R %3 a 0 0% %  0-0LS@P*00b0 .U 00 00 0-0@SLP*00b0 U 00 00 -LM0@S0C0K< 4("4 <0!  T 00 0 0-LM0@SP0C0  KT <(4"4!<0  8 -LPQFM0`,0 @] TC TR0 41 8! 0)p@S810(KOK 0< c@P! M?Kc@P8!N@TK?KS N/K⺄P8!9@, 0R(K081 4A 0p 0cP@.00<K_K<N/K81 劄p 8!+A[ Vi 0-L@PrP0kP fP  0h` -0LM $0 $K K 0-LM@PT :T 80K0! 80KP 0088 0-LM@PT :T 80K0! 80KP 0088 - LR *0R0 - LR *0R0 0-LM@PT :T 80K0! 80KP 0088 0-LM@PT :T 80K0! 80KP 0088 0-LM@PT :T 80K0! 80KP 1[088 0-LM@PT :T 80K0! 80KP 1[088 0-LM@PT :T 80K0! 80KP 1[088 0-LM@PT :T 80K0! 80KP 1[088 -LM0@K0!P00 -LM0@K0!P00 0-LM@PT :T 80K0S00! 80KP 00S0088 0R0-L@ P0PeS S S00P U00 P U  0, 00 0 0d -Lp@`PP \ 0S 0S \0S 0  -LMpPW *0$0 (  (KP KW0(KP 0$KP (0$@ @0P``0$K -LMpPW *0$0 (  (KP KW0(KP 0$KP (0$@ @0P``0$K -LM0@Sp`P S  KP R `V *V U  T F00 U 00 KPP  0d -L@P`pP @T PU * iU 0SW E00T WKPp 0 d ; -L M⠠P@8K0`px ( 0RP00P0#S  A( 0R$KͲ00i@( -L`M`\,  0 \ /00$ß, 0R(K 0|0 x0 t0 p0 l0 h0 d0 `0 /0 (K!0 0a T0c1\Tp q R |K1S q w Yp Rq w Ypw YpZKZK`,K 0S VX `V00P0#S w VV. @TB*:0V0) |KPdT!10RP5U3`V00P0#Sw 0S7 0S"*0n@Q@'*00f@WY Yh 0R  dPS R00J R*:00ZK #@= R*:00 i4G-P 0@Spp` R= $Q Q*.000W ^*0`0S%J.\ \\00W\00^: \Z0h0? 4 3 #^ #R0fY0Zh P *0S  0 Q0 SPlSPl0p4 00 P 00th -SL,M H L0 < @0 D0 80  L RL 8 D @  L0S@ D  L D D0SD @ 0S Hp8 R @0L IS, 0 00,`040  XT 0BP + SE Q D 0AS00D .W Z<0SappW .WQ \WpW0l SWw 0B>SlW a `P00bS:P.U \UPT q@nP T 0@ R0 08? 4 X0S4 80cQ<0S?#<  cAH0!c  p0S .S` 8Q (K0S 0@ R0 o|@ 00H< P*00H b80S @00@ R$ .0A Aa0ARS00A-Q S_Q\0 .Q .S \.\A Aa0ARS00A S0*S 0.S S R!0B]S,.R00S \\R R.R0S! C ]R0  0 <8 < 0 <0 Ƞ 40P 00h! ( -L"x@P`QM H JM hP -LM4K@`0IQ00 d  K00L ,P #RX  BX yd0@@`@ F@ -0LMp,`K,0K@PT MPe 0!00P XZ@`PTZ .T00X0S Z  ,K K` -LMpŸ0P,0 P@ P /00<, 0R|(K@@0:T<0 80 40 00 ' 2a -`S00LMV00Sp@ Vg$!V00/0 (! 1$1P 0S] \4 V (!0 R 0(1 R  0sCP  R$1 !0$1(! (!0R $1 0 \$1(!$Q(0U  0S (0PS(! : 0?CP (0U$Q0$100,1(1 8#0PS  0 P 1S 000^ P 00c0 !000 0 c -L M@  @4 < 0 D0 0 BP8 u 0 00尀X8p 8pP` 4 0bSE `XPڲ@TT 0 BpPU 0`㲀 XP<0LS8 @ D0ePq8 00014 00 `Pv9(Kp!  P9 ,  0BpP8@00004 fP<Q#D`DHDD8000(K  D0^ P 8 @0008 000,p9  ] P8 0008 000 K P @ D0P 8000 0SD00 00b0 -RL@1  0h͠00,1Ǡ00,1 0-LS00\00SP@ 1 \ 00hꩠ00,10裠00,1 -SL0@ hꑠ00,1Q  0RG G(G0G8G@GHGtF0 0" 00" 00" 00" 00" 00"0Q200" 00" -LM@p`@!  0, S,0K80 4 ( 0 0 R r 1S0C18K0PS U 0`=@$KlUdꔻ -LM0 0pSV  0S 0 0P60,0 K U& , R  Z `1`!@P00V0S V ,@PZ 0 00dS0 PdUP0,0 PU  U 1+#,PP`0 00`S0 (KPU B<B S@ <  ) U@1  `!`1!1>0 0f @`0 0 00jS0 PdUPPx s 0 00PUb UR:,PG @ `@U0@`` 0@T:U6P3  00b0 @@0 =0 @0f Z0 c6P, ]  P0h0,0 8 =000PF 0 @00j =0 0e `@0  =0 00P `t p-LP `V 0@f00T`0T  ,P`@`ʼ0@00pp p-<`L0PS0@S!pꔻ p-@PL ``0S0 P0S p諞P 00phꔻM -PLp`PS J0SX@`PUZX輼 0-1L @R P Q. 0 0 0c0 0000  0 P @0P &10 P$000 08#8("(00B< S 0 0 p-LlM0@8CP`Z0+0 KpKmP00: S  Q;  0  SL ( 0R  xU p-LM0@C 00   KpK K`6PP h 0 SPP P 0000C0  0iPP\ -L MpP`0S9쀟@T@0S >P 0S$K$Km> 0@P0dp h0 F00!0C 0@000 p >0S >ꔻ0 -LMpP!8 0H!08!X0 P 21CPU@ J 0S W 0S `D@PUZX W00C0 (K `D 4K;8 0,E>P Z 4@ 8 7>Z4@S00P @85xT 0080 -L MUP`@@0!0SG$q@T 0 0S6 0@P0, P , 0`00 00C8#Ƞ -LMPႠ ` `("HQ% 0 Rp#p4`P) P 0 0`8#H0S0S 0P  dp  X0,  pP,  -LpP@` 0S"0Q00 0w4W@pT? V  R 0B8S`R 00  0R0S00ڲ00000 B! 00C0C0 0 00T00 PWW800C80C800C80R B 0\R! B@-Q1P  00P  -LlM@f3?P0S10@T.0`dY**0VXS'p0WXSpGY:0gSV P@>x/00TZ! Z Z KiVP$X@00z0@0(K *QP n0S @ H-=p@a0S \0S@@@T -L @P  - L@p0 S0 Rp-0SP`P` D4%LP`\pP 0P0 Q0Y` R00B,R S-R+R0S0 C,S R-S+S0SS0SSP0@-P@000L S0!00 00C^00L ST0 0-LMPK@ 0P $"B20b0 :R 8: B;0P  31C 0:S0 P0 00 0-0L-S@P +SPP U00c00 -0LJS@3 MS 00C S00 [?P 0/S 00K0C0  0zP 0.S )0CpP 0.S (0Cfh~J0C0 0[ mG-Mp _" 2e10!0\( 0S1 S; SP` $0/O0@Ѝ43Cc" a*B-BPoP`Y ;\(2@P`3e20!0\0S0$#Bb20aPoP` PEQ 3! 2C 0$#Bb20aOpP`1 !/ b21CUc01 ``L&"!B Ϡl   B 100/0cN!bS  \@! A!0 BA`10aR0BSB\ 2p 1C01 SS Q 43Cc" aPoP`YQQ4*gfff$I -LP( <3aL1aa Q R 10bSP001bSP00 -L(MRP0 L  21C9H0 ^J 0BT Bʌ V 21CL' 0080 4 8GP4 0, R0D` @ < !< Z,0&Ϡ2l10!0X03l20!0X00&1O Ttf!6 p6h&ϠD @0nC(lF8Ld0l`pQZpjmVpG6VjF6mFVpW1,PK,5Ϡ2l10!@ 3l#20X0Xp%1pZKP P P(KSp^hZ040 80 t,pd0%Ϡ2l10!0X03l20!0X00$1W^0$Ϡ82l10!0X03l20!0X00@ğ,KAP  Sd$$0 /Po0@0S@T SUQPRZ ,00K00 P0p,S0O/Q 5GE$Y@H@`_Y,p W^30S80  4 21C" 0080  N21C 80H Q4 ^2C P H)H 0@Q0 SLH 0R9H04  0S0 0R L4Q4 0L@RP0cPPpK,@PDG{ND@D/0C!bb@ae B!a10b cP0R P0H!0Ϡ0l $ "Bb$1a `34 1CcP0, 2n10!0P3n20!0P P 000S Ppc 1 SP0 0 L$@P@QQ,?E.Qnm$Ių4d R 10bSP001bSP00 -PLU`p@ +0c0h+ 0R 0R 0R 0R 0R 0c -L@M0hK0  ! 0SdPK dPK < P`pK< P (K\K PXTP\(0T(cP??0cc(pK2'1C0cq X0 sPnP\\0fP XP,7U“2g10\!0؀ 0 3g#20 `\0` \ T7p؀!\\ XP,,7`\` )7U“2n10!p 3n#200P P &P1 0c\0 Pw\XP,h6ᓎ2g10!00 3g#20^0 ^  21C0!0 R b S\ X0 {XP\PDh ,0;R T0 v>% 0Sh oP`P ` 0`K0`p?S` p `p` p 0/ P/`_P `  a pKKpPK`EK 0 !  0b p ȀgppVp Ȁ P* -RLXM`@0<S t@ @dl@ 0S(K@>0 >S dt@ l _(6P01t@ l0 @, p pP00PUa <Uy p@ d0S,Sn,0>C00 0q03W0Sj;Q,Qg QX5%0  00@T 50%  00Q ^ Xpş @0M͆0@l0, 0P(5 a %0` B00 P Y00 P 0 0 St t ^Y m l  pTd;S 0KP\DK PV 0,SSXKPN pWKğ @0M͆0@=\0 30 h0 3l, b 0#P0l0 B3P ppp\ \ d ` (@h  0dK0ph dKX0KXʲ p \ 00B00B0h0h"Ϡ12l10!h0Q0 3l20!0h R001$#Bb20a/0 dK 0S| x0 NRL\0KS\ @Eh , |Kh d ` 0!0Ta !0!100QP0P`0Xq"10 d1  PR,00jO  1 0RcX,K@Pz͆@ ,0la  pP  P0 P@>%0 >Sp@ dU}WJ \ 00B0C0BI%L*@H*P*\*`*Q,X* -L@ qP  h -LpP`3 0S@ t|3@ 0V X0(0T=H00(0(0000f@P ph`B t - @L -L M<0 8@ L4@ D Y<0K,0 (@ 0S 08@S2 0S&\- 0 S 0QM@  D0,K @'D 0 #0 1D ($K81 0 R< K 4 00 Qsp 0<KN$0@40 0@ /0<S+*X0<S0<SN"1)<0S{70< S0Sx*- ,0R Q \|Y`X% -<1<`8!VL C 0S͆]P !0"100 !0S X @pP$P_0@0XZ]PpZ0=0 @$PpD$P00Z$000\|%H>  -tL0Sd@0 0R  Ph,0Pd\B -@L1h1l 0-8L#@PA (Q0SW$P2 $PP+P0S. \0   B,0hE KPxP 0:S  P 0,00h,UPZdd\P*L*B p-<`L@@1  @P81pl P0 0 p-8`LP@&1 @1pl -@L1rh1l -LM8 4 8K8 K @_@P(K0* 8`K0@0S@W!C T9 0@K00@P 0@ ,P 8`K0@0S@T* S1 00K@V0@K0@ P 0@ ,P 8`K0@0S@W S 0KP  0K(KSVTTS 0-LM  K00[TK0 -L,M@<K^ K -,L@, 00P h%tT -,L@, 0q0P h;tX -Lhj Q Q0!0a0PR- \1,0l00 ?\0 00R- 0bR R ?R0̑03012<000QS@-@  \0l 1<0̠ \ L ?\0 0@@\ P T  0 0-R ,0l0>-S0c012 0 00 S 200 0 3# R02 P0 0 bQ B2c0 @- @0cR#3n\0CQ0C2 d  l0p@- HXH$H%X!! a. $.ȌT2Vh`@pP1#3P1 <2TPQP3100QP3100Q#2QPP ;; ;Sq0 P0-9XpTP@ U` V( 0@0000# p-L`P@@@`@p -LPP@`p P B`B0Q40A"A`R0E0U0@ EPU0r @0P 00`04S0`P0  0  ꐽ -X1L0ps3X@@`S P S `8?SPQ QU 000@U000#? 0S`Z?45VCq00ࡣ0aS S4#0C@@PUQ @T@Pꌽ p-`LP@@!aph -L@P0, 7 `p P  0G`pe -L@pPe P eL -;PpLg45^@càU WN^a lAi^<.0n0ðVU, UPp V* f(\\0"?DE iW U0naS S6#0c``< 0S00O@`V`ꌽA-;P`f45^@s àU VNŒ^ 2 0N0AA A^<.0n0ðWU U ?1"C 0\ A<V U0nrS S 7#0spp\?DE pWp/R 5/R 1 -p!   PLP` &:::S@ W 0@ 460@ P S460 PXP -p!   PLP` &:::S@ ?P @ P0@ 000#460@ 460 W V  RXU -p!   PLP` &:::S@ ?S@ S 0@ 460@ 460 W V0 PXU0 ;p-@TTLUo Z~T 000p54 "d a3000V `pT00U0SpP |Vp落;0 S-L@ ;0S P 0045S P [45S PP;0 S- L ;0S P P0045S -45S %R 0#03P;0 S- L ;0S P P 0045S 45S R 0#03PPPO? ` H !:0-LʠʠAL@N$^?&P@)0\^.0n04.U`U00P00S R 00000\ U0 0H0\6n "30  0000 -;L0M^P( $ 堏' ^ (P=O*1@@^ `0OO0   K\0O/ $K( K,$N$ \0O/@0 P0@00 ,@ $p4 < 8p PK4B0 ^0 ?^4@^ @T@0X0@@`" Ѝ) Z 030#0Z& ` 0 `0O PO ` P`` ЍG"04C0X0 Y ZnfQ&030#Q0516!P&030#0O/@0  Q ?Q 063UP030#&@Q `V`UP&0 A030#& -顏OLMX`p P  -顏OLMX`p P  -LXMt p p`| x0 x&Jᄪ.J`pDE媪ZoO`&l` t@|`8@ 4 , @` < 0 P d^ ^P 0 0(p(K |@K0 K<0K,Z48l p0O჏8K, K40K,8@4@<0*6々/00 E cXh 8@ 4 Šh0O⨀8@ 4 h  @ < @< @0"HXH%X$H\0 #Ƞ 88#8! Ƞᑃ.,Ƞ\d  D X c.D ᑕ,$.( 40T 2VD0gh`.8C \0C2 8\0CR0CTbP0CX`SdH ZHX \@ 0 3 #Z0#033#d` `FH d` JX H ;#;S` T<h)XX&h@%X (,8 ("( 8ᐂ.#8T Ƞ,ȠL r.L0P ᐖ$".H`LR20cWxp,8C T0C2T0CRZ0C2 aP0C X@S b`ZPT03#030# 3 #```F@ `` J `00` d`:%5ʠlhp` ^ l 0O/@0pl p 0O჏00 T030"S  pl /O p -LlM  ` 0 &J,JJJ@ 倠HD `^oOP`&@px` P`8@ 4 , @P < 0`  @cT ^ x 0O8K, K40K20^ <@ xP0O@K0 K<0K0`` 40@6|0 8<0 6*(|x("('x*D0 ,XX%X8`h0 D0l |`#Ƞd@ H Ƞh`.,Ƞl& `0 ld0!$Hខ(P` <#``X0 a&8H0 \` H` j&t p` X`P h(T` `g&T\唗)L xHp(Q2Pt.!8l@|T!LP\ 0V02PPhV0*(d`X^ 2\H@` V\`XP\xp*T3#0 Y2 Y 8 S030#p p,0Q0WC)*D@tP|`x 0<@ @P 4` (K%V! 0! 00 x  0O/0X@? ς^p x 0O/ -L,M0PPp,0 `1  9@KR0! 蠟 R0!  0Ā= 0P0 0    0@npV@@, 0R(Kju00 <bupW00 UiLN]T -0L@H $0"P H h Q *0S00S0 Q -LMTp,@KP` 0    0RK i -0LobfrgRBQ Alnn  `` @`Väp"d@`FT00æ?d@D`R ?V00S X W  40W  $@0iQH -LMp \, ` *: 0 0 tpl*h: 0 | x 0 V 00\ %\z^,P \h4T h,dpDdh,Dt$0P`(, 0R(K 0So$@ T@d Ϡ0lP0 U  ^00U#3   0 P[h p-0L@0  0$RP`@) I2#8# c .@1QS P00S 0N!QR P00S\Pp80\ -L M 0`^K~`r@P x10鎠7p@PJ XT0 00Q 1p\ ,&("(30b,>0A!0 S00QuKP& 01C0 0 @0 0 (68#8# cN(. 0B 0S   00C 0(K  -LPM0d(0  @0P ,0 U U  UXh@K?  P$ K0DPCM0SJ @<0C>S񟗶t     h     X L @  4        h  \   P        D     4 (                   0$0t 0SPU$0SD3  c P0 Pp 3P6P@    t *@< 00 2P6P0   R@0x0 0Z $%Z: U0 @0 |( 0R$K0000:(00 0000,00,0,00 S,01,, 1 20$00 0~0 0{ @0( ,0 t00q00n00k00h0(0e0 00a00^0 0[0 0X0* 0( ,0P00M00J0PPUJr;PD|s00l0 R 0So 008`,i $0` ->0>0L MS`4 0  (Ko?24, !Q, p0B0c, R,c0 S*0r 0P#R R * 0000#22Y1 (",0S* px 0t0 R!p00b b0 p0x 00h0Yp ,0S0C 0Q@t0S x0IP t`1, R B0 A0t0SP Pt0S P00AU00, p0S(K0pS( 0S 0 0t ,xp00p0, U S(Ko04JIPh 400a0ym40 -04 @0  -sLP"`P *"*R@ R@  B0B Ts0STD3 R8C0 S*(3  0 ""! ttXPUV P 2@` 0 S A00C:#:30#" 01#e3! Q1(1"(@0@R!o 1S$ R000 !R 0S *l1S1100S00@@( 0b SP1:U xiR>0N@ TK: X>0N@4 0( 00b00!S 0S  |i/ic  Vii(  b R 0@@. @0N(@a 5P 80|T4pd -L`/mVp P0S0 @0T  @00S0 h0 0CR0mp<0< @80T 0S$hU ꔻ -LMX`0 0&P,  8=>0>0S 4p(K80\>0>0Sp0(VUeB0 Ss*0帢 0p#r R k* ,0000#22P~ @ 00 1@tpW x t0R% U0QZi 0 0e6RpAC0SJ ,0 e Sp00ep0<0S 0S   0|S70S=xtp0, 0eRp000S 0S  (1@P03pp{ !000v 8  x h > )  j Z > h0@P0T3pD p000p ,0RA$r=  - PL M8 P6(0:CZ*`>0N&@8 ppe Ɵ0 +PP6(Q|0PSb ( a R^*0S98:b0\p 0S(KƟ0 0(RC 0JS1p00@`V 0R 1%S@ U0 S*5 00#2 @T0N@$20!0RPp"@^@Z p 0 #2 p0p080Q0S 80Sb (0c f 058#Ƞ@^@0000!1 B("(0,R1!Q0000$ğ0c02!0QB !R 8p00Q00Sg Ze i `d # 1,kp 00Qa  PxpTß0( 00/di(  bE < p4 p4 W:370#2000< ,0 , < `00V00 u Q000,  0V 0a WI,!!q4004 P^  ,20 B0R ^ ,"   0 ^ @@Q@0`4@00@`0#4 0  a (0 c:37 '8#8!1q14jp 00 44*p@ 0P01p@  0,00P  0 00S000R0, 0``4*YQ0``v<0`Q|p   -LM@8 `7jDppTPPU4 @#0SG#0S2 m 00S0 j@j4  (K$0 T,0 R(0:CV**`>00`  Tn`>:W<0TQP0 0.pP4Bj(Qp0"S ,0S8 (00 c b  i 001 0R0C0U i4 @ 80P 0S i 00x  V!1PdP(  b , pP 0dX p`DP.PgDP$ X0P0d0iP 00 iP 00a e P`( 000H<,ꔻ`0 p -LP`TiLq0S<<.0 N. @T, D *Q#Dp,0pdS@@p <@ 8 @0 ,00@S|0<0 t@ Q0Px0640 RCPt8px p080bp0x040h0TpW'  .@P TUX 0 0CR0T 0hH(K <(h@ 00 R !0S@iXl( R @@ ^P@T0 e2@OP (QD P4D h,P@@<@ 1p@<XH <T. t @BP P(T R*q0S,,P@tia P.0Dp(PL `P L 0@R00 @ P@PbD a e@ X0p@.@4Lꔻh` d4p -L`vgp0SP @0T * @00S0 $ L0 0CRP0U VgFX0 R TIg 009PPP ꔻx` -LM PK 00%0 @# 0ST  @0S0S Q 000100M3*2G-@0 084 0<0   0 0 8M4   0 < R00 P ` p@  l0 P ` p08 40< 0 0(0$ ,$ 0 84 0<(00 ( 0$0 ,, 08 40<0 (0$ , 0 8 40<0  (0$ , Ѝ 4 0 0-8 40<80 (0 $ ,<  -LMlIS@1 08 ,0 < 9 P8$Q `8! a p81q 8A 8Q 8a    $ ! (00 ,@@ 0PP 4`` 8q88p p < @?\\lK lK<00@ R < 0!@0 0 @ 1 $0 Q! BK@p0 0041 ( 40@,001 0#1 1 c81 `0*dH,a n`0lȠp (q p,(1P,&4 #'a01 ` 0eZ0 0 ( @#1b*,1 c̠1 c<1 ,1*00 (1n00 1dLp0'P#0  #0\00 0,00 10(1 0`#0&@#1nc81 `0dH00 000 0 &#0` P#0eZ00 0 00 b*1 *lȠ0(1 p0'a#0 @# *1l̠c<p`p 1 p0` ndL`p0& #0P'#p0,0Sp0  \U00 0 $ 1 t x 倀1  1|   !P `pP  ` `p Pp Pp @ P p @ tx |0!",#<  D H! L1 @P`p娀嬠 0$L%\&l'|(*,̠. !",#0A?@P$P`(`p,pԀ0ؠ48<@q@@pG@q @?P P8A4P`0``, 0R(KP p  00@1Qp P8A4P`0`Вi -L@MTqH`K@L0K %(PTK L P TP @@m0S!P,(Kc0+0H0 D0 @0 <0 80 40 00 ,0 (0 $0  0R0KPx ;Z 00#0@(T0,@D4D4 ,?0 si  H$H jL$h  p-LM,a0SF(Q1 R!A0SP 0 cK a0 0A0^00=x 0P@0A00SpPhPl ;0,P3 @( V?0ꔻL$  H$H H$  P0-LP `k@Te00 -XL0@SPN(<U*01 R<$!U3 p ;0,( ?U0 0`S U@1@!c R `  0Pd0dS0p U0S0 0P0e0oꔻL$  H$H  h H$@-M Ѝ@-MЍ! !P: ZŒŒ#! !P: `B!,aB 0>ZJJJJJJJJJJJJJJJJJJ }J xJ sJ nJ iJ dJ _J ZJ UJ PJKJFJAJ=Q:Q:Q:Q:Q:Q:Q}:Qx:Qs:Qn:Qi:Qd:Q_:QZ:QU:QP:QK:QF: QA: Q<: Q7: Q2: Q-: Q(: Q#: Q: Q: Q:Q:Q :Q:QA ? QA ? QA > QA > QA = QA = QA < QA < QA ; QA ; QA : QA : QA 9 QA 9 QA 8 QA 8 QA 7 QA 7 QA 6 QA 6 QA 5 QA 5 QA 4 QA 4 QA 3 QA 3 QA 2 QA 2 QA 1 QA 1 QA 0 QA 0 \aBC`B0QA 0  -L@hm+-*+@-Q:@- R (2 R R -PPPP RrPP B PP R  R00 B R000Ѥ000l\000Ѥ000 R \6 R B0-.40P<$DL%T \,Ġ̌8 R0 .Ġ̌ RA R B0-.80P8$HH%X X,ȠȌ8 R0 .ȠȌ RA R B0-.<0P4$LD%\ T,̠Č8 R0 .̠Č RA R'0 R@- RP1P P1P RrP1P  B P1P B@  R010 1  B R0q0`0q0`0q0`\0q0`0q0`0q0` R 0\6 R B0@-81, Ġ%̌T$\D#L0P  R0@ Ġ01#̌  R R B0@-81, Ƞ%ȌX$XH#H0P  R0@ Ƞ01#Ȍ  R R B0@-81, ̠%Č\$TL#D0P  R0@ ̠01#Č  R#@-PP@p0`V 010P T \ 0 S  ^ 0^\0=S P0fC10P$ -LM0 S=S  0S=S` K -- L^M⼠0Q`(0 qOoK`FppA@O?KC/MKl1 >]+* 0 0C0S2-S0!1!@-0@0 @0!00  -LMAPTpm V R0 X 0W@ P   0AV0P -LMR`  PU 0SPR U< 8 % ͆0! Q0pPP(K0 13 B1 00 0<0 8 010s0380 PU4 q 1S X!0R00S,  0S X 0SRQN 1SK 0 @ T0{ 0S00S\t@TG 00B Y > 0 1P0  @0 @, @' Y$0 S ಐR 0P |0Px  p0 Pg  (1S0C1, 0R00001p0q =W0 pU 80x03 |PJXG<4 001A  0 <30 BQ 1 11  00q ͆0! q0pq5 !D00^ 0 nP Q[ -L,Usage: %s ..., where is one of: instbin%s: %s not compiled in newfs_ext2fsmount_cd9660md5sha256sha512dfmountmount_ext2fsarchsyncnewfs_msdossttylndisklabelpaxtarfsck_ext2fscatifconfigsysctlrtsolping6datelessmoremount_nfsfdiskgrepfgrepegrepumountmount_msdosfscksignifymknodmkubootreboothaltmount_ffsdhclientcpgzipgunzipgzcatchmodchgrpchownfsck_ffsnewfsrmmtejectmkdirksh-shbioctlsleepmvexprdmesghostnamemain%s partition type is not `%s' (or use -I) -b bsize block size -D inodesize size of an inode in bytes (128 or 256) -F create file system image in regular file -f fsize fragment size -I do not check that the file system type is `Linux Ext2' -i density number of bytes per inode -m minfree minimum free space % -N do not create file system, just print out parameters -n inodes number of inodes (overrides -i density) -O N filesystem revision: 0 ==> REV0, 1 ==> REV1 (default 0) -S secsize sector size -s fssize file system size (sectors) -V verbose output verbosity: 0 ==> none, 4 ==> max -v volname ext2fs volume name -Z pre-zero the image file mke2fsilog2SSSWTWTbrdfsfsinitinit_resizeinoallociputwtfsioctl (GDINFO)%s: can't read disk label; disk type must be specified%s: block device%s: not a character-special device%s: can't figure out file system partition%s: `%c' partition is unavailable%s: `%c' partition overlaps boot program%s `%s' is not a valid number.`%s' is not a valid suffix for %s.%s `%s' is too large to convert.%s `%s' (%lld) is less than the minimum (%lld).%s `%s' (%lld) is greater than the maximum (%lld).usage: %s [ fsoptions ] special-device where fsoptions are: Bad inode size %d (only 128 and 256 supported)sector sizesector size `%s' is not a power of 2.verbosefragment sizebytes per inodefree space %number of inodesVolume name cannot be zero lengthD:FINO:S:V:Zb:f:i:l:m:n:qs:t:v:can't open file %scan't fstat opened %s%sr%s/dev/%s: open for read%s: open for write%s: getmntinfo%s is mounted on %sLinux Ext2Unable to determine file system sizecan't ftruncate %s to %lldcan't fstatvfs `%s'can't malloc buffer of %dCreating file system image in `%s', size %lld bytes, in %d byte chunks. writing image%s: %u is not a power of 2 %s: read error for sector %lld%s: write error for sector %lld%s: can't allocate buffer for inode %s: no free inode %llu in block group %u %s: inode %llu already in use %s: inode value out of range (%llu). %s: inconsistent bitmap block size must be a power of 2, not %u fragment size must be a power of 2, not %u fragment size %u is too small, minimum is %u block size %u is too small, minimum is %u block size %u is too large, maximum is %u block size (%u) can't be different from fragment size (%u) GOOD_OLD_REV file system format doesn't support %d byte inode Filesystem size %lld < minimum size of %lld Volume name is too longCan't allocate descriptors buffer%s: %u.%1uMB (%lld sectors) block size %u, fragment size %u using %u block groups of %u.0MB, %u blks, %u inodes. Cannot allocate I/O buffer Preposterous size %lld super-block backups (for fsck_ext2fs -b #) at: %*llu, ...%s: large_file rocompat feature is required to enable resize feature for this filesystem %s: Can't allocate a dindirect block%s: Can't allocate buffer for a dindirect block%s: Can't allocate buffer for group descriptor blocks%s: too many reserved group descriptors (%u) for resize inode%s: too many block groups for the resize feature%s: can't allocate block for lost+found %s: can't allocate blocks for lost+found %s: can't allocate block for root dir Error making filesystemff@fh@@f4fffȺ @@f`f ffunknown operand %sno value specified for %s%s: illegal argument combination or already setbs supersedes ibs and obsrecord operations require cbscbs cannot be zerocbs meaningless if not doing record operationsbuffer sizes cannot be zerobuffer sizes cannot be greater than %zdseek offsets cannot be larger than %qdnonenoxferunknown status %s%s: illegal numeric valueunknown conversion %s%s: illegal conversion combinationcbsconvfilesibsifobsofskipstatusnoerrornotrunc%s: end of device%s: short write on character device%s: short write on tape devicefiles is not supported for non-tape devicesstdoutinput bufferoutput buffercase conv and -DNO_CONV%zu+%zu records in %zu+%zu records out blockblocks%zu odd length swab %s %zu truncated %s %qd bytes transferred in %lld.%03ld secs (%0.0f bytes/sec) skip reached end of inputmainiieiiii:iij jusage: mount_cd9660 [-egjR] [-o options] [-s offset] special node session number is %s: %segjo:Rs:realpath %scd9660%s: Filesystem not supported by kernel%s on %suserquotagroupquotarwautoaccesstimeatimeexecsuidrdonlyupdateneedsdoes not need-o %s: option %s a value-o %s: option not supported%s: illegal value '%s'%s ("%s") = %s %s (%s) = %s usage: %s [-bcpqrtx] [-C checklist] [-h hashfile] [-s string] [file ...] error encoding base64cannot open %sstdout: write error%s: read errorbC:ch:pqrs:txbase64hex%s doesn't support %s ,unknown algorithm "%s"SHA256SHA512usage: %s [-hiklnP] [-t type] [[file | file_system] ...] df: %qd: %s 1024-blocks 512-blocks%-*.*s %s Used Available Capacity Mounted on Filesystem%-*.*s %*lld %10lld %11lld %5.0f%% %s %7s%-*.*s %*llu %9llu %9lld %5.0f%% %7llu %7llu %5.0f%% %s %-*.*s %s Used Avail Capacity Size1K-blocks%-*.*s %s Used Avail Capacity iused ifree %%iused Mounted onempty type listonly one -t option may be specified.hiklnPt:-h and -i are incompatible with -Pretrieving information on mounted file systems%s is not a local file system%s mounted as a %s file systemffsext2fsprmountmountfsmainnfs:@ufs%s: fstab uses outdated type 'ufs' -- fix pleasemfs%s: fstab type %s != disklabel type %susage: mount [-Aadfruvw] [-t type] mount [-dfrsuvw] special | node mount [-dfruvw] [-o options] [-t type] special node -o%s,%s on %s type %.*s (%sunknown flag%s %#x, ctime=%sv3v2udptcpsofthardintrnoconnrdirplus%s%s=%dwsizersizerdirsizetimeoretransmaxgrouplistreadaheadacregmin, %s=%dacregmaxacdirminacdirmax%s%s=%lu %smsdos%s%s=%u, %s=%uuidgid%s%s=0%onowin95direxecnorripgensextattprocfsversion %dlinuxstatfs %s on %s type %.*s: %s already mountedexec: mount_%sfork%s/mount_%sexec %s for %sno mount helper program found for %sforceAadfo:rswt:uvrqnoautounknown special file or file system %s.root_devicecan't find fstab entry for %s.%s has unknown file system type./var/run/mountd.pidsignal mountdasynchronousasyncexported to the worldkerberos uid mappingNFS exportedanon uid mappingexported read-onlynoatimenoaccesstimenodevnoexecnosuidwith quotasread-onlyroot file systemsynchronoussoftdep/usr/sbinmainiieiiii:iij jusage: mount_ext2fs [-o options] special node o:specified device does not match mounted devicefilesystem not supported by kernelmount table full%s on %s: %susage: machine [-a] usage: arch [-ks] machinearmv7armOpenBSDmain}@@}@h }p}p }p }` }@ } $%s: no default %s%s: illegal %s%s: bad %susage: %s [-N] [-a FAT-size] [-B boot] [-b block-size] [-c cluster-size] [-e dirents] [-F FAT-type] [-f format] [-h heads] [-I volid] [-i info] [-k backup] [-L label] [-m media] [-n FATs] [-O OEM] [-o hidden] [-r reserved] [-S sector-size] [-s total] [-u track-size] special [disktype] %s: bad FAT typevolume ID"*+,./:;<=>?[\]|%s: bad volume label%s: bad OEM stringbytes/sectorsectors/FATsectors/clusterdirectory entriesdrive headsmedia descriptornumber of FATshidden sectorssectors/trackwarning: %s is not a character device%s: unknown standard format%s: can't figure out partition info%s: unknown disk type%s: partition is unavailablebytes/sector (%u) is not a power of 2bytes/sector (%u) is too small; minimum is %u-%c is not a legal FAT%s optionblock size (%u) is not a power of 2block size (%u) is too small; minimum is %ublock size (%u) is too large; maximum is %usectors/cluster (%u) is not a power of 2number of FATs (%u) is too large; maximum is %uillegal media descriptor (%#x)/boot/%s%s: inappropriate file type or formatno room for info sectorno room for backup sectorbackup sector would overwrite info sectortoo few reserved sectorstoo many sectors/FAT for FAT12/16meta data exceeds file system sizewarning: sectors/FAT limits file system to %u clusters%u clusters too few clusters for FAT%u, need %uwarning: FAT type limits file system to %u sectors%s: %u sector%s in %u FAT%u cluster%s (%u bytes/cluster) bps=%u spc=%u res=%u nft=%u rde=%u sec=%u mid=%#x spf=%u spt=%u hds=%u hid=%u bsec=%u bspf=%u rdcl=%u infs= bkbs=%s: can't read sector %uNO NAMEFAT%uBSD 4.4%s: can't write sector %u160180320360720120014402880 $_(oH08< DL fT \ r`؈dl: (0 8 @#H3P#X3`2h3p3x#@@, @@Ĉ̈Ԉ܈  $ ,@4@<DLT\dlt|ȉ Љ ܉ $,4<DP\hpx@@@@  Ċ Њ ܊ @@$, 4 PC$<CDC$LCT`lxċ ̋ ԋ܋@@ $,printmainoption requires an argument -- %sundefmaximum option value is %d -- %soption requires a numeric argument -- %sdiscarddsuspeofeol2lnextminquitreprintstartstopsuspflushrprntillegal gfmt1 option -- %sillegal gfmt1 option%lxcflagiflagispeedlflagoflagospeedgfmt1:cflag=%x:iflag=%x:lflag=%x:oflag=%x:%s=%x:ispeed=%d:ospeed=%d TIOCSTOPTIOCSTARTTIOCSETD%d %d rows %scols %sillegal option -- -%scbreakcolscookeddecekeverythingextproclcasenewoldostartostoprawrowssanespeedttycs5cs6cs7cs8cstopb-cstopbcread-creadparenb-parenbparodd-paroddparity-parityevenp-evenpoddp-oddppass8-pass8hupcl-hupcl-hupclocal-clocalcrtscts-crtsctsmdmbuf-mdmbufignbrk-ignbrkbrkint-brkintignpar-ignparparmrk-parmrkinpck-inpckistrip-istripinlcr-inlcrigncr-igncricrnl-icrnliuclc-iuclcixon-ixon-flowixoff-ixofftandem-tandemixany-ixanydecctlq-decctlqimaxbel-imaxbel-echoechoe-echoecrterase-crterasecrtbs-crtbsechok-echokechoke-echokecrtkill-crtkillaltwerase-altweraseiexten-iextenechonl-echonlechoctl-echoctlctlecho-ctlechoechoprt-echoprtprterase-prteraseisig-isigicanon-icanonnoflsh-noflshtostop-tostopflusho-flushopendin-pendin-crtnewcrt-newcrtnokerninfo-nokerninfokerninfo-kerninfoxcase-xcaseopost-opostlitout-litoutocrnl-ocrnlolcuc-olcuconlcr-onlcronlret-onlretonocr-onocrtabs-tabsoxtabs-oxtabsonoeot-onoeot tablet disc; slip disc; ppp disc; strip disc; nmea disc; #%d disc; ispeed %d baud; ospeed %d baud;speed %d baud; %d rows; %d columns;lflags-extprociflagsoflagscflagscchars%s = %s;%-8susage: %s [-a | -e | -g] [-f file] [operands] -aefgaef:gnot a terminalTIOCGETDTIOCGWINSZgfmt1illegal option -- %stcsetattrTIOCSWINSZlinkitusage: %s [-fhLnPs] source [target] %s [-fLPs] source ... [directory] %s/%s%s: disappeared%s and %s are identical (nothing done).FfhLnPscmplabelduid_parsegetasciilabeleditEĺmpsavehas_overlapgetuint64editor_allocspaceedit_parmsedit_parmseditor_resizeeditor @ 8 @ @H P@@ \ @h(@t %(@@  `NH@_@@d@ L|<DP\dl|ذ2n$4nHpinذ $(,4q$(\s6㿂;{vc'9O8'm:="! 5Ei[HZqv8E>}N.{7{iXiz^T ]Z|ת"4.yw'篒W;}&167M*Qd *OUwit{Uvj_ɿEr>yϒ3y?'0,&in_2YfӫJʫ\%/)*y.LJ(}qUJt3[_5Ƈ?7(>S‹dDy|H>\SCf .gTSͼY#j{^g!a:x&Q?I-7nOt{UJ^N>-=;UQTw;?h+  8)Jf_ZtúV=LU*x\\%ޟ]%')JG?x$x > aO bC{d%rsV:[ ɚZkb {W%n$9l܀!dhIuj*{IZD2 11˵j]RR hgN jW20Ȁ pqf](#SYgW~gQAWO 9MH:_c(̠IfQV-M5pag5;m ?kMQJaqVJ!sӐq/fzwnE"ӳKw;8zuz[SW ZjrfryZ<`b" #o\4Ut+Nj2;,&}C0_¸aP}؝ȫ5J=n: a?8F5͈V̈U2f`HACڼ$w&P*)f•tu&=<9;#0 :MmA*&x"PTp'okm7 Q@*U=kQh%w(DVG٠HA_ㆁ}hSEaP3Ay:_rB"2Obbg%9A#) M6Es 4/[2NiJ Yҷj.dйmЭ/mP;rqt}%_0Jb蟄4Zy)bJ! (F!0"c "6<owًH? X4 [='jW$cKb<jC>j .)hTB=Ƀ|Q͝)kԈvN8a6X7 7B:=-Am$a'>ݔ0"D]4![ 8ź}\, pUoqqo>%yC F'.!ApekK"("bܣa6$uδPslU 9&AVْ7 psXjD*%# a^H֡]_w9/Uij-[~k+sd˥IP>8fqChB03N{r,M0"ksem,LdD5daYx#64pYJv0:[8Xm%Q"lX6`qW:_PcRf5l(ۮ~fRDxx2<hS y(֠Amdirm… Z9EFy!G *S vzPpsB:&LIV9nҍpiE+o]u×<|Rsyj L"~`0RQCDSbEɖZP7`F'~uMV74܉<:FͪZwNwS|UxC*`}!#,Cqm6nLTʩuӢAn|*yT:IJl<O,u{Ќz&t9<z^0! YV=ٷ5H3Vmd]N+}>|>_Pu0c_U\5U]ay|yZ8 qZQ#j7b;+ 1|DH-moM. T1 p16NG1fJY<ހ|+m8[e*Db>!93q@Aqh|j-ŞJZdܝcz4ʚ2rTxvR1*ח`vQ陁%)95'J9EOZ;/VT\xɥi4Q;YQ'v/cX؀Z'cdz6[UA6,ӾVȘp$ ``'0u_#GXUv%dێGׁ2덂K:w.~3=bxܻv\$f=`&vHIQRܱ49 .(V-n5½c*I5x@(Y BL wfX `O:/Pqa޹W YV69x)L? rx4UF d3jkr뼇Q ;X(g:D7wWv5ӈK`4+Ʈ "YP]-f`Jz߉-k t2ƻF? A F_*W*TͧBwW`4"*}<ka̬egﺮ0x ;BTzi_}Vo3WqQ^5S7\=CxD kQzD y{<*Mi@̂B8ɶn0, \B-_0żdmgQœP &CO C2u}|:B93MR6W$p9֙Q'P`roolT3sWNizr0*Ldܰ*21y6xi%ejsL[1%і8M1.ȴt\%KK'7>5{O,ȲE1oT)? J>E2gğ\w0')y'2E&3b6dܼW e\יoHiUWg<ܵB G 9'HF5Q&P.Uj\M{~ ƿ; SY43eJCX"nQ[&KA; iT~Q%]l$68"k<>5g.PCqsSYJy9E#e3f ͹ 7ӋKl@"MӰSOvο&v 㲅01\IB&b4* gka7^gI)JIZ##C-K8i)wG`l10E};]bc9C †6>9: -M~oրDh͞H 716yrIr$>}=6M?7eWb1yA/z bQת3pW$(GQ?~ty\>,+L%0\]5L6KyJ0ʕ02x#x]\}y6VOn`ǎ B\vNt4PL/ϻuqs͘Z~VMs=vP~#0Ư RM {mo\թ5^%J0-6dkprc]@aJxBU9F`ij$c_3-ȸ;$B[4O#a[a=%2hZH?(]/[rDA?>-)/>zV;(҇TҨqiﾭ\@T0||JXH>s6,?PAM+M%%&AajLWsb~H~*׋Kwx7-/ҕi `F_Mkf&uÿhwꆚUzyϟ<2ڽC-Rusage: disklabel [-Acdtv] [-h | -p unit] disk (read) disklabel -w [-Acdnv] disk disktype [packid] (write) disklabel -e [-Acdnv] disk (edit) disklabel -E [-Acdnv] [-F|-f file] disk (simple editor) disklabel -R [-nv] disk protofile (restore) `disk' may be of the form: sd0 or /dev/rsd0%c. `disktype' is an entry from %s, see disktab(5) for more info. /etc/disktab`packid' is an identification string for the device. `protofile' is the output from the read cmd form; -R is powerful. sector size %dsectors/track %dtracks/cylinder %dcylinders/unit %dboot block size %dwarning, boot block size %% sector-size != 0super block size %dwarning, super block size %% sector-size != 0warning, number of partitions (%d) > MAXPARTITIONS (%d)warning, partition %c: size 0, but offset %llupartition %c: offset past end of unitpartition %c: partition extends past end of unitwarning, unused partition %c: size %llu offset %llu # line %d: syntax errorunknownIDEESDIline %d: warning, unknown disk type: %sbadsectvendorline %d: bad flag: %sdrivedataline %d: bad drivedata %s%d partitionsline %d: bad # of partitionsduidline %d: bad %s: %ssectors/cylindertracks/cylindercylindersrpminterleavetrackskewcylinderskewheadswitchtrack-to-track seektotal sectorsboundstartboundendline %d: bad partition name: %sline %d: too few fieldsline %d: bad partition size: %sline %d: bad partition offset: %sline %d: warning, unknown filesystem type: %sline %d: unknown field: %sVISUALEDITOR/usr/bin/vi%s %s/bin/sh%s: No disk label on disk%s: Label magic number or checksum is wrong! (disklabel or kernel is out of date?)%s: Open partition would move or shrink%s: Labeled partition or 'a' partition must start at beginning of disk%.*s|Automatically generated label:\ :dt=se#%u:ns#%u:nt#%u:nc#%u:sc#%u:su#%llu:d%d#%u\ :p%c#%llu:o%c#%llu:t%c=%s:t%c=unknown%d:b%c#%u:f%c#%u:Bootstrap doesn't leave room for disk labelioctl DIOCRLDINFOioctl DIOCGPDINFOioctl DIOCGDINFO/dev/%s%c%02hhx%02hhx%02hhx%02hhx%02hhx%02hhx%02hhx%02hhx.aioctl DIOCWDINFOunknown disk type: %s %c: %16llu %16llu %c: %15.*f%c %16llu %7.7s%7d %5u %5u %4hu %19.19s# %s# %s: type: %s type: %d disk: %.*s label: %.*s duid: %02hhx%02hhx%02hhx%02hhx%02hhx%02hhx%02hhx%02hhx flags: badsect vendorbytes/sector: %u sectors/track: %u tracks/cylinder: %u sectors/cylinder: %u cylinders: %u total sectors: %llu # total bytes: %.*f%cboundstart: %llu boundend: %llu drivedata: %d %hu partitions: # %16.16s %16.16s fstype [fsize bsize cpg] offset # Notes: # Up to 16 partitions are valid, named from 'a' to 'p'. Partition 'a' is # your root filesystem, 'b' is your swap, and 'c' should cover your whole # disk. Any other partition is free for any use. 'size' and 'offset' are # in 512-byte blocks. fstype should be '4.2BSD', 'swap', or 'none' or some # other values. fsize/bsize/cpg should typically be '2048 16384 16' for a # 4.2BSD filesystem (or '512 4096 16' except on alpha, sun4, ...) No changes.re-edit the label? [y]: bckmgtBCKMGTValid units are bckmgt ABEf:F:hRb:cdenp:tvwSMDMSCPold DECSCSIST506HP-IBHP-FLtype 9floppyccdvndATAPIRAIDunusedVersion6Version7SystemV4.1BSDEighth-Edition4.2BSDMSDOS4.4LFSHPFSISO9660ADOSHFSADFSNTFSUDF-cTreating sectors %llu-%llu as the OpenBSD portion of the disk. You can use the 'b' command to change this. OpenBSD area: ; size: ; free: # %16.16s %16.16s fstype [fsize bsize cpg] Can't stat deviceAvailable commands: ? | h - show help n [part] - set mount point A - auto partition all space p [unit] - print partitions a [part] - add partition q - quit & save changes b - set OpenBSD boundaries R [part] - resize auto allocated partition c [part] - change partition size r - display free space D - reset label to default s [path] - save label to file d [part] - delete partition U - undo all changes e - edit drive parameters u - undo last change g [d|u] - [d]isk or [u]ser geometry w - write label to disk i - modify disklabel UID X - toggle expert mode l [unit] - print disk label header x - exit & lose changes M - disklabel(8) man page z - delete all partitions m [part] - modify partition Suffixes can be used to indicate units other than sectors: 'b' (bytes), 'k' (kilobytes), 'm' (megabytes), 'g' (gigabytes) 't' (terabytes) 'c' (cylinders), '%' (% of total disk), '&' (% of free space). Values in non-sector units are truncated to the nearest cylinder boundary.%02hhx%02hhx%02hhx%02hhx%02hhx%02hhx%02hhx%02hhx.%c%s%c none swap sw %s%c %s %s rw 1 %d failed to sort partition table%s: [%s] [d]isk or [u]ser geometryEnter 'd' to use the geometry based on what the disk itself thinks it is, or 'u' to use the geometry that was found in the label.Command aborted BIOS geometry not defined. Note: user geometry is the same as disk geometry. You must enter either 'd' or 'u'. Where to mount this filesystem (ie: / /var /usr)'%c' already being mounted at '%s' Mount points must start with '/' The disklabel UID is currently: %02hhx%02hhx%02hhx%02hhx%02hhx%02hhx%02hhx%02hhx The disklabel UID, given as a 16 character hexadecimal string.Invalid UID entered. partition to deleteThe letter of the partition to delete, a - p, or '*'.Partition must be between 'a' and '%c' (excluding 'c'). Partition '%c' is not in use. partition to nameThe letter of the partition to name, a - p.You cannot name a filesystem of type %s. can't get mem sizePossible values are:"IDE", "%s"Disk typeWhat kind of disk is this? Usually SCSI, IDE, ESDI, ST506, or floppy."%s" is not a valid disk type. Valid types are: Error, partitions %c and %c overlap: Disable which one? (^D to abort) [%c %c] %s: [%llu] %lldRounding size to cylinder (%d sectors): %llu FS typeFilesystem type (usually 4.2BSD or swap)FS type (decimal)Filesystem type as a decimal number; usually 7 (4.2BSD) or 1 (swap).Invalid entry Unrecognized filesystem type '%s', treating as 'unknown' Size of ffs blocks. A multiple of the ffs fragment size.Error: block size must be at least as big as page size (%d). Error: block size must be a multiple of the fragment size (%llu). Align partition to block sizeRound the partition offset and size to multiples of bsize?Rounding offset to bsize (%llu sectors): %llu Rounding size to bsize (%llu sectors): %llu Size of ffs block fragments. A multiple of the disk sector-size.Error: fragment size must be a multiple of the disk sector size (%d) Zero fragment size implies zero block sizeSize of the partition. You may also say +/- amount for a relative change.The size must be > 0 sectors The size can't be more than %llu sectors, or the partition would extend beyond the last sector (%llu) of the OpenBSD portion of the disk. The 'b' command can change this limit. Sorry, there are only %llu sectors left partition to change sizeThe letter of the partition to change size, a - p.Partition %c is currently %llu sectors in size, and can have a maximum size of %llu sectors. Starting sector for this partition.The offset must be >= %llu and < %llu, the limits of the OpenBSD portion of the disk. The 'b' command can change these limits. The offset must be in a free area. partition to modifyThe letter of the partition to modify, a - p.No space left, you need to shrink a partition The letter of the new partition, a - p.Partition '%c' exists. Delete it first. Starting sectorThe start of the OpenBSD portion of the disk.Size ('*' for entire disk)The size of the OpenBSD portion of the disk ('*' for the entire disk).Changing device parameters for %s: What kind of disk is this? Usually SCSI, ESDI, ST506, or floppy (use ESDI for IDE).label name15 char string that describes this label, usually the disk name.The Number of sectors per track.The number of tracks per cylinder.The number of sectors per cylinder (Usually sectors/track * tracks/cylinder).number of cylindersThe total number of cylinders on the disk.The total number of sectors on the disk.You may want to increase the size of the 'c' partition.Not enough free space to shrink by %llu sectors (only %llu sectors left) partition to resizeNo such partition Cannot resize spoofed partition [+|-]new size (with unit)new size or amount to grow (+) or shrink (-) partition including unitAmount too big Partition %c shrunk to make room No room left for all partitions You need to specify a type for this disk.can't run when there is partition overlap.No 'c' partition found, adding one that spans the disk.Label editor (enter '?' for help at any prompt) unable to get default partition tableThis option is not valid when run without the -f flag. PAGER/usr/bin/lessgunzip -qc|%sunable to execute %sIn no change mode, not writing label.No label changes.Write new label?Write the modified label to disk?unable to write labelResize only implemented for auto allocated labels Free sectors: %16llu - %16llu (%16llu) Total free sectors: %llu. FilenameName of the file to save label into.Original label and mount points restored.Last change undone.EnteringExiting%s expert mode Unknown option: %c ('?' for help) /tmp/var/usr/usr/X11R6/usr/local/usr/src/usr/obj/homelfsadosntfsudfsdrzwdFLOPPYxdhdCCDVNDsvndabcdfiklnoprstuvwxBDEGHLPTUXYZ0Cannot append to an archive obtained from a pipe.Cannot append, device record size %d does not support %s specForward positioning operation on archive failedCannot allow updates to an archive with flaws.Unable to recover from an archive read failure.Attempting to recover from an archive read failure.Reverse positioning on pipes is not supported.Unable to obtain current archive byte offsetReverse position on previous volume.Unable to seek archive backwardsUnable to locate tape filemark.Unable to backspace over tape filemark.Unable to backspace over last tape block.Cannot determine archive tape blocksize.Tape drive unable to backspace requested amountUnable to backspace tape over %d pad blocksUnable to backspace tape %d blocks.Failed read on archive volume %dEnd of archive volume %d reachedWrite failed, archive is write protected.Unable to append, trailer re-write failed. Quitting.Failed write to archive volume: %dWARNING: partial archive write. Archive MAY BE FLAWEDWARNING: partial archive write. Archive IS FLAWEDUnable to truncate archive file%s: Waiting for tape drive close to complete...done. %s: unknown format, %llu bytes skipped. %s: %s vol %d, %lu files, %llu bytes read, %llu bytes written. could not pipecould not fork-dccould not exec %sFailed open to read on %sFailed open to write on %sFailed open to read/write on %sFailed chdir to %sFailed stat on %sCannot write an archive on top of a directory %sUnable to set signal maskUnable to restore signal mask ATTENTION! %s archive volume change required. %s ready for archive tape volume: %d Load the NEXT TAPE on the tape drive%s ready for archive volume: %d Load the NEXT STORAGE MEDIA (if required) and make sure it is WRITE ENABLED. Type "y" to continue, "." to quit %s, or "s" to switch to new device. If you cannot change storage media, type "s" Is the device ready and online? > Quitting %s! %s unknown command, try again Cannot re-open %s, try again Switching to a different archive Ready for archive volume: %d Input archive name or "." to quit %s. Archive name > Empty file name, try again Illegal file name: .. try again File name too long, try again Cannot save archive name.Cannot open %s, try again directory name is too long %sCannot access destination directory %sDestination is not a directory %sDestination pathname too long %sUnable to open %s to readCannot identify format. Searching...Sorry, unable to determine archive format.Premature end of file on archive readArchive I/O error, cannot continueArchive I/O error. Trying to recover.Unable to append, archive header flawInvalid header, starting valid header search.Cannot mix current archive format %s with %s%s: Reading archive to position at the end...Cannot chdir to %sCan't fchdir to starting directoryUser specified archive volume byte limit reached.Read fault on %sFile changed size during read %sFile %s was modified during copy to archiveUnable to obtain block size for file %sFailed write during copy of %s to %sFile %s changed size during copy to %sFailed stat of %sFile %s was modified during copy to %sActual crc does not match expected crc %sUnable to append when there are archive read errors.Archive read error limit (%d) reachedCannot append to an archive that may have flaws.Unable to rewrite archive trailer, cannot append.Write block size %d too large, maximium is: %dWrite block size %d is not a %d byte multipleWrite block size of %d too large, maximium is: %dWrite block size of %d is not a %d byte multipleWrite block size of %d larger than POSIX max %d, archive may not be portableUnable to allocate memory for group name cache tableUnable to allocate memory for user name cache tableUnable to allocate memory for group id cache tableUnable to allocate memory for user id cache tableFile changed size %sFile %s was modified during readFile rewind failed on: %sFailed seek on file %sFailed write to file %sFile seek on %sWARNING! Major Internal Error! GNU hack Failing!Out of memoryCould not set permissions on %sUnable to set file uid/gid of %sAccess/modification time set failed on: %sUnable to close file descriptor on %sUnable to copy %s, file would overwrite itselfUnable to remove directory %sCould not unlink %scannot follow symlink %s in chain for %s%s skipped. Sockets cannot be copied or extracted%s has an unknown file type, skippingCould not create: %scpioCould not access %s (stat)Unable to link file %s to itselfUnable to remove %sCould not link to %s from %sUnable to link to %s from %sA hard link to the directory %s is not allowedUnable to create %sIgnoring unterminated pathname at EOFIgnoring too-long pathname: %sCan't chdir to %snext_fileFile system cycle found at %sUnable to read directory %sFile system traversal errorUnable to access %sUnable to read symlink %sWARNING! These file names were not selected:Invalid file name argumentUnable to allocate memory for filenameUnable to allocate memory for file name buffer%b %e %H:%M%b %e %Y%s%s %s %s%2u %-*.*s %-*.*s %4lu, %4lu %9llu == -> %s: unknown option %c %s: %c argument missing Invalid option nameUnable to allocate space for option listInvalid options formatusage: tar {crtux}[014578befHhjLmNOoPpqsvwXZz] [blocking-factor | archive | replstr] [-C directory] [-I file] [file ...] tar {-crtux} [-014578eHhjLmNOoPpqvwXZz] [-b blocking-factor] [-C directory] [-f archive] [-I file] [-s replstr] [file ...] usage: pax [-0cdjnOvz] [-E limit] [-f archive] [-G group] [-s replstr] [-T range] [-U user] [pattern ...] pax -r [-0cDdijknOuvYZz] [-E limit] [-f archive] [-G group] [-o options] [-p string] [-s replstr] [-T range] [-U user] [pattern ...] pax -w [-0adHijLOPtuvXz] [-B bytes] [-b blocksize] [-f archive] [-G group] [-o options] [-s replstr] [-T range] [-U user] [-x format] [file ...] pax -rw [-0DdHikLlnOPtuvXYZ] [-G group] [-p string] [-s replstr] [-T range] [-U user] [file ...] directory Invalid block size %sbzip2compress/dev/rst0/dev/rst1/dev/rst4/dev/rst5/dev/rst7/dev/rst8b:cef:hjmopqruts:vwxzBC:HI:LNOPXZ014578-IUnable to open file '%s' for readProblem with file '%s'-Cwrite_opt=nodirTAPEInvalid -p string: %cUnknown -x format: %spax: Known -x formats are: Invalid write limit %sWrite limit is not a %d byte multipleError count value must be positiveab:cdf:ijklno:p:rs:tuvwx:zB:DE:G:HLOPT:U:XYZ0%s: Invalid combination of options: -%cDestination directory was not suppliedThese format options are not supported %s = %s ustarFile name %s/%s, too longWARNING! These patterns were not matched:Replacement name error %sReplacement name too long %s >> %s%s >> %s >> %s Removing leading / from absolute path names in the archive ATTENTION: %s interactive file rename operation. Input new name, or a "." to keep the old name, or a "return" to skip this file. Input > Try again, illegal file name: .. Try again, file name too long Skipping file. Processing continues, name unchanged. Processing continues, name changed to: %s Pattern select out of memoryPattern list inconsistentEmpty pattern stringUnable to allocate memory for pattern stringEmpty replacement stringInvalid replacement string %sUnable to allocate memory for replacement string%s while compiling regular expression %sInvalid replacement string option %sCPU time limit reached, cleaning up. Signal caught, cleaning up. Can't open current working directory.TMPDIR/tmp/Cannot allocate memory for temp file name.Unable to set up signal handlercan not gzip while appendingEmpty time range stringImproperly specified time range: %sUnable to allocate memory for time rangeBad option %c with time range %sIllegal lower time range %sIllegal upper time range %sUpper %s and lower %s time overlapTime range format is: [[[[[cc]yy]mm]dd]HH]MM[.SS][/[c][m]]Unable to allocate memory fo group selection tableCannot determine gid for group name: %sGroup selection table out of memoryUnable to allocate memory for user selection tableUnable to find uid for user: %sUser selection table out of memoryCannot canonicalize %sUnable to store mode and times for created directory: %sUnable to allocate memory for directory timesCannot allocate space for directory access time tableCannot allocate memory for device mapping tableCannot allocate memory for interactive rename tableCannot allocate memory for hard link tableDirectory access time reset table ran out of memoryDevice map table out of memoryUnable to fix truncated inode/device field when storing %sArchive may create improper hard links when extractedNo interactive rename table, links may failCannot update rename tableInteractive rename table out of memoryHard link table out of memoryFailed ftime table seekFailed ftime table readFailed write to file time tableFailed seek on file time tableFile time table ran out of memoryCannot allocate memory for file time tablepaxXXXXXXXXXXUnable to create temporary file: %sUstar cannot archive a socket %sLink name too long for ustar %sFile name too long for ustar %sFile is too long for ustar %snobodyUstar header field is too small for uid %lu, using nobodyUstar header field is too small for gid %lu, using nobodyUstar header field is too small for %sTar cannot archive a character device %sTar cannot archive a block device %sTar cannot archive a socket %sTar cannot archive a fifo %sLink name too long for tar %sFile name too long for tar %sFile is too large for tar %sTar header field is too small for %sInvalid extended header lengthInvalid extended header recordInvalid extended header record lengthExtended header record length %lld is out of rangeMalformed extended header recordlinkpathwrite_optnodirUnknown tar format -o option/value pair %s=%s%s=%s is the only supported tar format option%s=%s is only supported when writing.%s: /dev/ttyFatal error, cannot open %susage: ping [-DdEefLnqRrv] [-c count] [-I ifaddr] [-i wait] [-l preload] [-p pattern] [-s packetsize] [-t ttl] [-V rtable] [-w maxwait] host patterns must be specified as hex digits%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2x%2xPATTERN: 0x%02xVr HL TOS Len ID Flg off TTL Pro cks Src Dst Data %1x %1x %02x %04x %04x %1x %04x %02x %02x %04x %s TCP: from port %u, to port %u (decimal) UDP: from port %u, to port %u (decimal) Echo ReplyDestination Net UnreachableDestination Host UnreachableDestination Protocol UnreachableDestination Port Unreachablefrag needed and DF set (MTU %d) frag needed and DF setSource Route FailedNetwork UnknownHost UnknownSource IsolatedDest. Net Administratively ProhibitedDest. Host Administratively ProhibitedDestination Net Unreachable for TOSDestination Host Unreachable for TOSRoute administratively prohibitedHost Precedence ViolationPrecedence CutoffDest Unreachable, Unknown Code: %d Source QuenchRedirect NetworkRedirect HostRedirect Type of Service and NetworkRedirect Type of Service and HostRedirect, Unknown Code: %d(New addr: %s) Echo RequestRouter Discovery Advertisement(%d entries, lifetime %d seconds) Router Discovery SolicitationTime to live exceededFrag reassembly time exceededTime exceeded, Unknown Code: %d Parameter problem, required option absent: pointer = 0x%02x Parameter problem: pointer = 0x%02x TimestampTimestamp ReplyInformation RequestInformation ReplyAddress Mask RequestAddress Mask Reply (Mask 0x%08x) Unknown ICMP type: %d --- %s ping statistics --- %ld packets transmitted, %ld packets received, %ld duplicates, -- somebody's duplicating packets!%.1f%% packet lossround-trip min/avg/max/std-dev = %d.%03d/%d.%03d/%d.%03d/%d.%03d ms packet too short (%d bytes) from %s%d bytes from %s: icmp_seq=%u ttl=%d time=%d.%03d ms (DUP!) (TRUNC!) wrong data byte #%d should be 0x%x but was 0x%x%x %d bytes from %s: LSRR: 0.0.0.0 %s (truncated route) (same route) RR: NOP unknown option %xping: sendtoping: wrote %s %d chars, ret=%d setresuidnumber of packets to transmit is %s: %sbad interface address: %sbad timing interval: %s%s: only root may use interval < 1spreload value is %s: %spacket size is %s: %sttl value is %s: %srtable value is %s: %ssetsockopt SO_RTABLEmaxwait value is %s: %sDEI:LRS:c:defi:l:np:qrs:T:t:V:vw:unknown host: %s-f and -i options are incompatibleNo audible output for flood pingsbind-R option and -D or -T, or -t to unicast destinations are incompatiblerecord route not valid to multicast destinationsping: record routesetsockopt IP_MULTICAST_LOOPsetsockopt IP_MULTICAST_TTLsetsockopt IP_MULTICAST_IFgetsockoptsetsockoptCannot set the receive buffer sizeCould only allocate a receive buffer of %d bytes (default %d)PING %s (%s): %d data bytes PING %s: %d data bytes ping: recvfrommakeentrylinkupfileerroriblockckinodemainpass2pass2checkpass5setup<DP\dl|ذ2n$4catchquitNO SPACE LEFT IN %s (EXPANDED)EXPANDUNREFDIRLINK COUNT %s COUNT %d SHOULD BE %dLINK COUNT INCREASING (ADJUSTED)ADJUSTUNREF %s (RECONNECTED)RECONNECTNO lost+found DIRECTORYCREATE (CREATED)SORRY. CANNOT CREATE lost+found DIRECTORYlost+found IS NOT A DIRECTORYREALLOCATESORRY. CANNOT CREATE lost+found DIRECTORY SORRY. NO lost+found DIRECTORY SORRY. NO SPACE IN lost+found DIRECTORYDIR I=%llu CONNECTED. PARENT WAS I=%llu NAME=%s %s=%s DIRECTORY CORRUPTEDwrong type to dirscan %d lost+found%d %s I=%lluBAD STATE %d TO BLKERR cannot find inode %llu bad inode number %llu to nextinode Cannot allocate space for inode buffer bad inode number %llu to ginode blk %d < cgdmin %d; blk + cnt %d > cgsbase %d blk %d >= cgdmin %d; blk + cnt %d > cgdmax %d LARGE FILES UNSUPPORTED ON REVISION 0 FILESYSTEMSSETTING LARGE FILE INDICATOR SET LARGE FILE INDICATORTRYING TO SET FILESIZE TO %llu ON MODE %x FILE I=%llu OWNER=%u MODE=%o SIZE=%llu MTIME=%12.12s %4.4s cannot increase directory list PARTIALLY TRUNCATED INODE I=%lluDIRECTORY %s: CONTAINS EMPTY BLOCKSADJUST LENGTHYOU MUST RERUN FSCK AFTERWARDSCLEAR (CLEARED)-%c flag requires a %s usage: %s [-dfnpy] [-b block#] [-m mode] filesystem ... Alternate super block location: %d bad mode to -m: %o ** lost+found creation mode %o b:dfm:npystarting CAN'T CHECK FILE SYSTEM.** Last Mounted on %s ** Root file system** Phase 1 - Check Blocks and SizesINTERNAL ERROR: dups with -p** Phase 1b - Rescan For More DUPS** Phase 2 - Check Pathnames** Phase 3 - Check Connectivity** Phase 4 - Check Reference Counts** Phase 5 - Check Cyl groups%d files, %d used, %d free %d files missing %d blocks missing The following duplicate blocks remain: %d,The following zero link count inodes remain: %llu, ***** FILE SYSTEM WAS MODIFIED ***** ***** PLEASE RERUN FSCK ***** ***** REBOOT NOW *****EXCESSIVE BAD BLKS I=%llu (SKIPPING)CONTINUEEXCESSIVE DUP BLKS I=%lluuDUP TABLE OVERFLOW.PARTIALLY ALLOCATED INODE I=%lluINODE I=%llu HAS DTIME=%12.12s %4.4s (CORRECTED)bad size %llu:HOLD BAD BLOCKbad size %llu ndb %d:bad direct addr: %d bad indirect addr: %d LINK COUNT TABLE OVERFLOWINCORRECT BLOCK COUNT I=%llu (%d should be %d)UNKNOWN FILE TYPE I=%lluROOT INODE UNALLOCATEDALLOCATECANNOT ALLOCATE ROOT INODE DUPS/BAD IN ROOT INODEROOT INODE NOT DIRECTORYFIXBAD STATE %d FOR ROOT INODE DIRECTORY TOO SHORTDIRECTORY %s: LENGTH %lu NOT MULTIPLE OF %dMISSING '..'BAD INODE NUMBER FOR '..'BAD INODE NUMBER FOR '.'BAD TYPE VALUE FOR '.'MISSING '.'CANNOT FIX, FIRST ENTRY IN DIRECTORY CONTAINS %s CANNOT FIX, INSUFFICIENT SPACE TO ADD '.' BAD TYPE VALUE FOR '..'CANNOT FIX, SECOND ENTRY IN DIRECTORY CONTAINS %s CANNOT FIX, INSUFFICIENT SPACE TO ADD '..' EXTRA '.' ENTRYEXTRA '..' ENTRYI OUT OF RANGEREMOVEUNALLOCATEDDUP/BADZERO LENGTH DIRECTORY%s %s %s IS AN EXTRANEOUS HARD LINK TO DIRECTORY (IGNORED)BAD TYPE VALUEBAD STATE %d FOR INODE I=%llu ZERO LENGTHBAD/DUP%u: %2x summary info for cg %d is %d, %d, %d,should be %d, %d, %d SUMMARY INFORMATIONS WRONG FOR CG #%dblk_bitmap:bbmap:BLK(S) MISSING IN BIT MAPS #%dino_bitmap:ibmap:INODE(S) MISSING IN BIT MAPS #%dsummary info bad in superblock: %d, %d should be %d, %d SUPERBLK SUMMARY INFORMATION BADstrdup failedrealloc failedmalloc failed/r%s (%s): UNEXPECTED INCONSISTENCY; RUN %s MANUALLY. Can't stat rootCan't stat %s %s is not a character device ioctl (GCINFO): %s %s: can't read disk label %s: CANNOT FIGURE OUT FILE SYSTEM PARTITION %s: NOT LABELED AS A EXT2 FILE SYSTEM (%s) BAD SUPER BLOCK: %s MAGIC NUMBER WRONGBAD LOG_BSIZEcompat 0x%08x, incompat 0x%08x, compat_ro 0x%08x INCOMPATIBLE FEATURE BITS IN SUPER BLOCKsuperblock mismatchesoffset %ld, original %ld, alternate %ld VALUES IN SUPER BLOCK DISAGREE WITH THOSE IN FIRST ALTERNATECan't stat %s: %s %s is not a character deviceCan't open %s: %s ** %sNO WRITE ACCESS (NO WRITE)cannot allocate space for superblock LOOK FOR ALTERNATE SUPERBLOCKS%s %s %s %s %s %s SEARCH FOR ALTERNATE SUPER-BLOCKFAILED. YOU MUST USE THE-b OPTION TO FSCK_FFS TO SPECIFY THELOCATION OF AN ALTERNATESUPER-BLOCK TO SUPPLY NEEDEDINFORMATION; SEE fsck_ext2fs(8).USING ALTERNATE SUPERBLOCK AT %d state = %d ** F%sile system is clean; not checking ** File system is already clean IMPOSSIBLE RESERVED BLOCK COUNT=%d IN SUPERBLOCKSET TO DEFAULTWRONG FPG=%d (BPG=%d) IN SUPERBLOCKBAD SUMMARY INFORMATIONcannot alloc %u bytes for blockmap cannot alloc %u bytes for statemap cannot alloc %u bytes for typemap cannot alloc %u bytes for lncntp cannot alloc %u bytes for inphead returning to single-user after filesystem check bad file type 0%o cannot allocate buffer pool INTERNAL ERROR: GOT TO reply()%s? no %s? yes %s? [Fyn?] (SALVAGED)SALVAGEUNKNOWN INODESC FIX MODE %d CANNOT %s: BLK %dProgram terminated SEEKWRITETHE FOLLOWING SECTORS COULD NOT BE WRITTEN: %ld,PARTIALLY WRITING %sZERO'ED BLOCK %d TO DISK UPDATE STANDARD SUPERBLOCKSPanic: lost %d buffers MARKING FILE SYSTEM CLEAN MARK FILE SYSTEM CLEANcache missed %ld of %ld (%d%%) READTHE FOLLOWING DISK SECTORS COULD NOT BE READ: %ld (%ld),deadlocked buffer pool %6d usage: %s [-benstuv] [file ...] benstuv1((9(9(9(9(9999,::::4 :4(:0:8:<:D:@L:,X:нh:xt: |: T.(:(.ܡ:T.l:::ԯ:(:T:::: /</,:X:;;(;4;H<;D;L;T;\;h;p;t;l9|;(;(; (;(;@(;(;ļ;;Dܻ;;;(|;4i i@/@/t9$i i/d2 ; ;`< <<<$<i0<$f#8<#@<#H<#L<$T<$\<$d<$h<%p<%x<%<%<&<&<'<'<(<(<)<)<*<*<+<+<,=,=,=-=-(=-,=.4=.@=/H=/T=0\=0h=0p=0|=1=1=2=2=2=3=3=3=4=4=4=5=5>6 >6>6 >7,>78>c@>cL>dP>d\>eH<e`>h>l>p>t>x>>>>>>>>>>>>>>>>>>? ???$?0?X?d? h? t?x?????? P? ? ?`?`?????? ?@@@$@8@H@GT@H@`@P?P?P?h@h@h@ذTp@@@@@@randommalformed link-level addressSIOCSIFLLADDRSIOCGIFXFLAGSSIOCSIFXFLAGS[#%d]SIOCG80211WPAPARMSSIOCS80211WPAPARMSSIOCGIFFLAGSSIOCSIFFLAGSSIOCIFDESTROYmedia mode %smediaopt instance %d"%.*s"0xSIOCGIFGROUPgetifgroups groups:usage: ifconfig [-AaC] [interface] [address_family] [address [dest_address]] [parameters] invalid channel %s: %sSIOCS80211CHANNELprefix %s: %sSIOCGIFMEDIA%s: no link type?only one `instance' command may be issuedmust specify `media' before `instance'media instance %s: %smtu %s: %sSIOCSIFMTUbad hexadecimal digitshexadecimal digits too longstrings too longSIOCS80211NWIDmalformed BSSID: %sSIOCS80211BSSID%s: bad value%s=%o%s=%xSIOCGETVLANSIOCSETVLANvlan tag %s: %s vlan: %d parent interface: %s SIOCG80211ALLCHANS %4s %-8s %s chanfreqproperties %4d %4d MHz passive scan%d: bad prefixleninvalid vlan tag and device specificationinvalid %s %s: %s%s not allowed for the AFvltimepltimenwid chan %u bssid %s lladdr %s %u%% %udB powersave %uMESSIBSSCF_POLLABLECF_POLLREQPRIVACYSHORT_PREAMBLEPBCCCHNL_AGILITY SPECTRUM_MGMT QOS SHORT_SLOTTIME APSDDSSSOFDMDELAYED_B_ACKIMMEDIATE_B_ACKCACHEBSSAUTHASSOCCOLLECT no permission to scanSIOCG80211ALLNODES none restoreunknown %s media mode: %sonly one `mode' command may be issuedinvalid media mode: %sunknown %s media subtype: %sonly one `media' command may be issuedmay not issue `media' after `mode' commandsmay not issue `media' after `mediaopt' commandswpagroupcipher: unknown cipher: %sstrdupunknown %s media option: %sonly one `-mediaopt' command may be issuedmay not issue both `media' and `-mediaopt'only one `mediaopt' command may be issuedmay not issue `mediaopt' after `instance'wpaciphers: unknown cipher: %spsk802.1xwpaakms: unknown akm: %swpa1wpa2wpaprotos: unknown protocol: %s ieee80211: nwid chan %u bssid %s %u%% %udB nwkey persist%d: wpakey wpaprotos %swpa2 wpaakms %s802.1x wpaciphers wpagroupcipher powersave on (%dms sleep) (auto) %ddBm%sHIDENWIDNOBRIDGEUPBROADCASTDEBUGLOOPBACKPOINTOPOINTNOTRAILERSRUNNINGNOARP PROMISC ALLMULTI OACTIVE SIMPLEX LINK0LINK1LINK2MULTICASTTXREADYNOINET6INET6_NOPRIVACYMPLSWOL rdomain %d metric %lu mtu %lu lladdr %s status: %s %s: no media types? media: supported media: tunnel: inet%s %s -> %s:%u vnetid %d ttl %dpersist:SIOCS80211NWKEY: too many keys.SIOCS80211NWKEYunsetifgroup: group names may not end in a digitunsetifgroup: group name too longSIOCDIFGROUPsetifgroup: group names may not end in a digitsetifgroup: group name too long SIOCAIFGROUPSIOCG80211NWIDwpakey: invalid pre-shared keywpakey: passphrase must be between 8 and 63 characterswpakey: nwid not setwpakey: passphrase hashing failedSIOCS80211WPAPSKinterface index is already filledgetifaddrscould not determine link local address inet6 %sSIOCGIFDSTADDR_IN6 -> %sSIOCGIFNETMASK_IN6 prefixlen %dSIOCGIFAFLAG_IN6 anycast tentative duplicated detached deprecated autoconf autoconfprivacy scopeid 0x%xSIOCGIFALIFETIME_IN6 pltime infty vltime inet %sSIOCGIFNETMASKSIOCGIFDSTADDR --> %s netmask 0x%xSIOCGIFBRDADDR broadcast %sSIOCIFCREATEinvalid carp demotion: %scarpdemoteSIOCSIFGATTRSIOCGIFGATTR carp demote count %d%s: no such interface SIOCGIFGMEMBprintgroupinterface name '%s' too longcreatedestroyinet6'%s' requires argument'%s' requires 2 argumentsSIOCDIFADDRSIOCAIFADDRarp-arpdebug-debugalias-aliasdeletenetmaskmtunwid-nwidbssid-bssidnwkey-nwkeywpa-wpawpaakmswpacipherswpagroupcipherwpaprotoswpakey-wpakey-chanbroadcastvlanvlandev-vlandevgroup-groupanycast-anycasttentative-tentativeeui64autoconfprivacy-autoconfprivacypowersavepriorityrtlabeltxpowernwflagrdomain-inet6descriptiondescrwol-wollink0-link0link1-link1link2-link2mediamediaopt-mediaoptinstanceinstlladdrinetEthernetetherFDDIIEEE802.11TDMCARPautoselectmanual10baseT10baseT/UTP10UTP10base210base2/BNC10BNC10base510base5/AUI10AUI100baseTX100TX100baseFX100FX100baseT4100T4100baseVG100VG100baseT2100T21000baseSX1000SX10baseSTPSTP10STP10baseFLFL10FL1000baseLX1000LX1000baseCX1000CX1000baseT1000T1000baseTX1000TXHomePNA1HPNA110GbaseLR10GLR10GBASE-LR10GbaseSR10GSR10GBASE-SR10GbaseCX410GCX410GBASE-CX42500baseSX2500SX10GbaseT10GT10GBASE-T10GSFP+Cu10GCuSingle-modeSMFMulti-modeMMFCDDIFH1FH2DS2DS5DS11DS1DS22OFDM6OFDM9OFDM12OFDM18OFDM24OFDM36OFDM48OFDM54OFDM72t1t1-amie1e1-g.704e1-amie1-ami-g.704t3t3-m13e3e3-g.751e3-g.832e1-g.704-crc411a11b11gfhmasterfull-duplexfdxhalf-duplexhdxflag0flag1flag2loopbackhw-loopbacklooprxpausetxpausedual-attachdasadhochostapibssibss-mastermonitorturbohdlc-crc16pppframerelay-ansiframerelay-ciscoframerelay-ituno carrierno networkbackupactivekeepalive downusegroupwep40tkipccmpwep104displayprinttimeprintlong %s: %s: %s: directory causes a cyclefts_readCOLUMNS1ACFHLRSTacdfghiklmnopqrstux%b %e %H:%M:%S %Y%*llu %*qd total %llu %s %*u %-*s %-*s %3d, %3d %*s%*qd %*s ls: %s: %s usage: %s [-1AaCcdFfgHhikLlmnopqRrSsTtux] [file ...] usage: sysctl [-n] name %s=kern.osreleasehw.machinehw.modelhw.producthw.disknameshw.ncpufoundwarnmsgrtsol_timer_updateifconfigmake_packetmainrtsol_check_timerrtsol_inputsendpacketrtsol_inputsendpacketsockopeninterface_statusinterface_upget_rdomainlladdropt_fillinterface_statusinterface_upget_llflagget_rdomaindefrouter_probedefrouter_probe:sendprobeprobe_initmultiple interfaces foundreallocprobing %s<%s> %sillegal interface state(%d) on %sstop timer for %sset timer for %s to %lld:%ldfailed to get link layer information for %sinterface %s was already configuredmemory allocation failedlink-layer address option has null length on %s. Treat as not included.memory allocation failed for %susage: rtsol [-DdF] [-O script-name] interface ... rtsol [-DdF] -a usage: rtsold [-1DdFfm] [-O script-name] interface ... rtsold [-1DdFfm] -a adDFO:adDfFm1O:kernel is configured not to accept RAskernel is configured not to accept redirectskernel is configured as a router, not a hostfailed to open a socketfailed to initialize interfacessetting rdomain %ufailed to initialize %sfailed to setup for probing routerstimer expiration on %s, state = %d%s status is changed from %d to %dNo answer after sending %d RSsthere is no timerNew timer is %lld:%08ldselect: %srecvmsg: %sfailed to get receiving interfacefailed to get receiving hop limitpacket size(%zd) is too shortinvalid icmp type(%d) from %s on %sinvalid icmp code(%d) from %s on %sinvalid RA with hop limit(%d) from %s on %sinvalid RA with non link-local source from %s on %sreceived RA from %s on an unexpected IF(%s)received RA from %s on %s, state is %dsend RS on %s, whose state is %dsendmsg on %s: %smalloc for receive msghdr failedmalloc for send msghdr failedff02::2inet_pton failed for %sIPV6_RECVPKTINFO: %sIPV6_RECVHOPLIMIT: %ssetsockopt(ICMP6_FILTER): %sunsupported link type(%d)ioctl(SIOCGIFFLAGS) on %s: %sioctl(SIOCGIFMEDIA) on %s: %sioctl(SIOCGIFFLAGS): %sioctl(SIOCSIFFLAGS): %schecking if %s is ready...socket(SOCK_DGRAM): %sgetifaddrs: %sioctl(SIOCGIFAFLAG_IN6): %sget_llflag() failed, anyway I'll try%s is ready%s is tentative%s is duplicatedget_rdomain socket: %ssysctl(ICMPV6CTL_ND6_DRLIST): %smalloc: %sdefault router list contains a non-link-local address(%s)probe a router %s on %sshutdown: %snigrouppr_iphdnsdecodesummarypr_rthdrpr_icmphpr_nodeaddrpr_packmainZRZ$Z,Z usage: ping6 [-dEefHmNnqtvWw] [-a addrtype] [-b bufsiz] [-c count] [-g gateway] [-h hoplimit] [-I interface] [-i wait] [-l preload] [-p pattern] [-S sourceaddr] [-s packetsize] [-V rtable] [hops ...] host ff02::2:0000:0000-%uVr TC Flow Plen Nxt Hlim %1x %02x %05x %04x %02x %02x %s->\%03o --- %s ping6 statistics --- +%ld duplicates, %.1lf%% packet lossround-trip min/avg/max/std-dev = %.3f/%.3f/%.3f/%.3f ms path MTU for %s is notified. (ignored) NodeInfo Supported Qtypes, compressed bitmap, raw bitmap???nxt %u, len %u (%d bytes), type %u, %d segments, segments unknown, %d left [%d] [%d]%s nxt %u, len %u (%lu bytes) Jumbo Payload Opt: Length %u Router Alert Opt: Type %u Received Opt %u len %lu HbH Options: Dst Options: Routing: sendmsgping6: wrote %s %d chars, ret=%d IP6HBH DSTOPT FRAG RTHDR AH ICMP6: type = %d, code = %d ESPUnknown Header(%d) No Route to DestinationDestination Administratively UnreachableDestination Unreachable Beyond ScopeDestination Unreachable, Bad Code: %d Packet too big mtu = %d Time exceeded, Bad Code: %d Parameter problem: Erroneous Header Unknown Nextheader Unrecognized Option Bad code(%d) pointer = 0x%02x Listener QueryListener ReportListener DoneRouter SolicitationRouter AdvertisementNeighbor SolicitationNeighbor AdvertisementRedirectDestination: %s New Target: %sNode Information QueryNOOPSupported qtypesDNS namenodeaddrIPv4 nodeaddrunknown qtype, subject=%s(%s), oldfqdn, no subject, subject=%sDNS label(invalid), invalidNode Information Reply, %sBad ICMP type: %drefused truncated no address %s(TTL=infty)(TTL=%u)invalid peernamefailed to get receiving packet information%d bytes from %s, icmp_seq=%u hlim=%d dst=%s time=%.3f ms(DUP!)extra (%d bytes %s)refused, type 0x%xunknown, type 0x%xunknown code 0x%x, type 0x%xNodeInfo NOOPTTL=%d:meaninglessTTL=%d:invalidTTL=%d03 draftno nameinvalid namelen:%d/%luinvalid socket buffer sizeMust be superuser to flood pingillegal hoplimit %sillegal hoplimit -- %sillegal timing interval %stoo small interval, raised to 0.01Must be superuser to preloadillegal preload value -- %s-R is not supported in this configurationinvalid source address: %sillegal datalen value -- %sdatalen value too large, maximum is %da:b:c:dEefHg:h:I:i:l:mnNp:qRS:s:tvV:wWtoo many intermediate hopsgetaddrinfo failedgetaddrinfo for the gateway %s: %sgateway resolves to multiple addressessetsockopt(IPV6_NEXTHOP)setsockopt(IPV6_RECVHOPOPTS)setsockopt(IPV6_RECVDSTOPTS)-f and -i incompatible optionsUnable to allocate packetIPV6_MULTICAST_HOPSsetsockopt(IPV6_USE_MIN_MTU)setsockopt(IPV6_RECVPATHMTU)setsockopt(ICMP6_FILTER)setsockopt(IPV6_RECVRTHDR)can't allocate enough memory%s: invalid interface namecan't initialize rthdrbad addr family of an intermediate addrcan't add an intermediate nodeUDP socketUDP setsockopt(IPV6_PKTINFO)UDP setsockopt(IPV6_UNICAST_HOPS)UDP setsockopt(IPV6_MULTICAST_HOPS)UDP setsockopt(IPV6_RTHDR)UDP connectgetsocknameyou need -b to increase socket buffer sizesetsockopt(SO_SNDBUF)setsockopt(SO_RCVBUF)setsockopt(IPV6_RECVPKTINFO)setsockopt(IPV6_RECVHOPLIMIT)PING6(%lu=40+8+%lu bytes) %s --> pollrecvmsgnew path MTU (%d) is notified IPv6 addressIPv4 addressSuccessRefusedusage: %s [-aju] [-d dst] [-r seconds] [-t minutes_west] [-z output_zone] %-*s[+format] [[[[[[cc]yy]mm]dd]HH]MM[.SS]] illegal time formatUTCcannot unsetenv TZad:jr:ut:z:settimeofday%a %b %e %H:%M:%S %Z %Yspecified date is outside allowed rangeCould not get local time of dayadjtimedate set by %stoo many argumentsconversion error?f%f .?m(%T %i of %m) .?ltlines %lt-%lb?L/%L. .byte %bB?s/%s. ?e(END) :?pB%pB\%..%tHELP -- ?eEND -- Press g to see it again:Press RETURN for more., or q when doneWaiting for data?n?f%f .?m(%T %i of %m) ..?e(END) ?x- Next\: %x..%t?f%f .?m(%T %i of %m) .?e(END) ?x- Next\: %x.:?pB%pB\%:byte %bB?s/%s...%t?f%f .?n?m(%T %i of %m) ..?ltlines %lt-%lb?L/%L. :byte %bB?s/%s. .?e(END) ?x- Next\: %x.:?pB%pB\%..%tCannot allocate memoryLESSSECURE-G-L-XLESS--WARNING: terminal is not fully functionalLESS_TERMCAP_DEBUG<%s>LESS_TERMCAP_krklkukdkPkNkh@7kDLINESlicoTERMhcxndadbsgpcticdcmsomdmbvbbc|^srNothing in top lineNothing in bottom lineNo bracket in top lineNo bracket in bottom lineNo matching bracketseek error to 0ch_ungetchar overrunseek errorESC^%c*s<%X>less %s(P)+Non-match First-file EOF-ignore Keep-pos Regex-off &/Pattern not found& [Press space to continue, 'q' to quit.]There is no %s optionCommand not available(N-th) No %snext fileNo %sprevious fileNo such filemark: goto mark: Brackets: [Press 'h' for instructions.]Warning: some edit commands disabledWarning: some commands disabled"%s" may be a binary file. See it anyway? Missing filename ("less --help" for help)LESSMETAESCAPELESSMETACHARS; *? '"()<>[]|&^`#\$%=~%c%s%c%s %s %sLESSCLOSELESSOPEN...skipping... Cannot seek to that file positionDetermining length of fileDon't know length of fileCannot seek to end of fileCannot seek to beginning of fileCannot seek to line number %nLESSANSIENDCHARSLESSANSIMIDCHARS0123456789;[?!"'#%()*+ Line numbers turned offCalculating line numbersInvalid mark letterMark not setUse "h" for help-" must be followed by 1 or 2 charsquotes %sTab stops and then every %d spacesless Copyright (C) 1984-2009 Mark Nudelman less comes with NO WARRANTY, to the extent permitted by law. For information about the terms of redistribution, see the file named README in the less distribution. Homepage: http://www.greenwoodsoftware.com/less #Invalid column fractionInvalid column numberHorizontal shift %d columns.%06dHorizontal shift %s of screen widthjInvalid line fractionInvalid line numberPosition target at screen line %dPosition target at screen position %sValue is required after %sNumber is required after %s--%s-%c (--%s)No such optionCannot change the %s optionCannot query the %s optionCannot use "-+" or "--" for a string optionCan't use "-!" for a numeric option-%sThere is no %s option ("less --help" for help)LESS_IS_MOREBe less helpful in promptsBe helpful in promptsSearch includes displayed screenSearch skips displayed screenSearch includes all of displayed screenMax buffer space per file (K): Max buffer space per file: %dKDon't automatically allocate buffersAutomatically allocate buffers when neededRepaint by scrolling from bottom of screenRepaint by painting from top of screenAssume intelligent terminalAssume dumb terminalDon't quit at end-of-fileQuit at end-of-fileQuit immediately at end-of-fileOpen only regular filesOpen even non-regular filesDon't quit if end-of-file on first screenQuit if end-of-file on first screenDon't highlight search matchesHighlight matches for previous search onlyHighlight all matches for previous search patternBackwards scroll limit: Backwards scroll limit is %d linesCase is significant in searchesIgnore case in searchesIgnore case in searches and in patternsTarget line: 0123456789.-Don't display a status columnDisplay a status columnInterrupt (ctrl-C) returns to promptInterrupt (ctrl-C) exits lessDon't use the LESSOPEN filterUse the LESSOPEN filterShort promptMedium promptLong promptDon't use line numbersUse line numbersConstantly display line numbersprompt: Ring the bell for errors AND at eof/bofRing the bell for errors but not at eof/bofNever ring the bellDisplay control characters as ^XDisplay control characters directlyDisplay control characters directly, processing ANSI sequencesDisplay all blank linesSqueeze multiple blank linesFold long linesChop long linesDisplay underlined text in underline modeBackspaces cause overstrikePrint backspace as ^HDon't highlight first unread lineHighlight first unread line after forward-screenHighlight first unread line after any forward movementTab stops: 0123456789,Send init/deinit strings to terminalDon't use init/deinit stringsForward scroll limit: Forward scroll limit is %d linesScroll window size: Scroll window size is %d linesquotes: Don't show tildes after end of fileShow tildes after end of fileHorizontal shift: 0123456789.Use keypad modeDon't use keypad modeUse new bottom of screen behaviorUse old bottom of screen behaviorF command follows file descriptorF command follows file namefakeInvalid patternNo previous regular expressionPlease re-enter search patternNothing to searchmainiieiiii:iijHq jTtttot o@$t,too0t 8t@@tpp$p0pusage: %s [-23bcdilsTU] [-a maxreadahead] [-g maxgroups] [-I readdirsize] [-o options] [-R retrycnt] [-r readsize] [-t timeout] [-w writesize] [-x retrans] rhost:path node hostname too longno : or @ speccan't resolve address for host %sNFS PortmapCannot MNT RPCbad MNT RPCcan't access %s: %s-2 and -3 are mutually exclusiveillegal -a value %s: %sillegal -g value %s: %sillegal -I value %s: %sconflicting version optionsillegal -R value %s: %sillegal -r value %s: %sillegal -t value %s: %sillegal -w value %s: %sillegal -x value %s: %s23a:bcdD:g:I:iL:lo:PR:r:sTt:w:x:Ubgconndumbtimernfsv3mntudpresvportnfsv2acmainUSER_print_diskUSER_modifygetuintask_pidask_numask_cmdMBR_pcopyunused DOS FAT-12 XENIX / XENIX /usr DOS FAT-16 Extended DOSDOS > 32MB NTFS AIX fs AIX/Coherent OS/2 Bootmgr Win95 FAT-32 Win95 FAT32LDOS FAT-16 Extended LBAOPUS OS/2 hidden Compaq Diag.OS/2 hidden OS/2 hidden OS/2 hidden AST swap Willowtech ThinkPad Rec Willowsoft $NEC DOS 'Win Recovery8Theos 9Plan 9 @VENIX 286 ALin/Minux DRBLinuxSwap DRCLinux DR MQNX 4.2 Pri NQNX 4.2 Sec OQNX 4.2 Ter PDM QDM RCP/M or SysVSDM TOntrack UEZ-Drive VGolden Bow \Priam aSpeedStor cISC, HURD, *dNetWare 2.xxeNetWare 3.xxfNetWare 386 gNovell hNovell iNovell pDiskSecure uPCIX Minix (old) Minix (new) Linux swap Linux files*OS/2 hidden Linux ext. NT FAT VS NTFS VS Linux LVM Amoeba FS Amoeba BBT Mylex BSDI NotebookSaveFreeBSD OpenBSD NEXTSTEP MacOS X NetBSD MacOS X bootMacOS X HFS+BSDI filesy*BSDI swap Solaris CTOS DRDOSs FAT12DRDOSs < 32MDRDOSs >=32MHPFS DisbledCPM/C.DOS/C*Dell Maint SpeedStor SpeedStor SpeedStor BeOS/i386 EFI GPT EFI Sys SpeedStor DOS 3.3+ SecSpeedStor Xenix BBT XwriteXreinit[[s۸~EWflO)Ŗ,aO9vr:I=gv*5%C$$qL&9ɤξb+Fw 7W׷:fWWvkrU:;0tU|.{xws1E  'VYQȕ\'* \g"SNV.~qQ|~_Zh<(D?I 9Tl"h*BOE6FR,d dž>c "SMC݊_ǜE;G&/*!:+qiavbw>`$2_jOR%LqI(A^dtUɾLRYjkTY(@b\6~ou-9R2R 4۝։[5WCbi)hOF{-5Sq3b*>Lŕy_r,85@2l]<~M/I%C#2J6(#ϬEtv2նa7a) kx舃Y+ ?P_L,CƉ ϖfti ֖;_z->p0ȟ2ic5.f) حqRG"ЭZWdvC-?5~O@K|މkq})./;NWxq#n~7 JHB,i]_oϦe&QNg[{'ߞp0zѨ7>gp4OQn|\z~W(:-Y}^#׈}%}.[y+_Hw#q|xp9{x~+{%~AHH~cs28;þC%g#SZQnv}ۯѸ5 p5t:狱@_G'vvnFOg'g!L‮5sqEó?_Nh(:t_Ɨmoiloߩ(9RL4b6>% h4UCwhdFp S"k+ _ _- )>&֎Bq;c>OVхR {]#!EYy.@d~N^Vo/j|㺐n |cx,Q%[",S*bdaU E2&ף-0̨/ڝbFbp=AəB2,UB1E{dvyڗR8J4"<[EtӦgwNV 7R^n rE-ٟx ?nܼ:oo}McD<`}NfedI|x=P_*k|=Jf&oK3*P]HX6(I҄rT|K0V#tQ+Qy[HR"x&[r}ZD4̃8kϼH]FYg*Nޛ)#8av @]0sy{y{ݩFA+ys%~W/ƣwOQOd<VǥHl*{.+{&dNgHXKqy#nދć+@AS{ #܆ yN(ٷiK*=_)b \8uyj46Se7/wi&ˆs}JjQcq:F4ӼC.dz TK R.GL=(gec^ណ]jiN01%.#rC[ңv6xfKzt[je _WTVGoSյ(uU!) _`",K,568SHj- 8X;M+b kEk߶U0:^3O6&sѮ7JPH Q<\9^SZk(d"g ߹ȩ5WAɍLer^!QNS [QK7vEQZmh=kXt`A5\QUS-$?.&(ocUħ{E@rAgH f>l7\դu-LI 0>|?C|@_./ܘzm:ٳD6ʇ(NJ/El.*2'2۝T3ZspjI2_'HTbjr[ExKY>[NرR 4i &Cqy!mFFJZӄQ}Getns]UT <"Xq* G(6-pTWW{u5K̿k+ xd߁oy`xt~|:0vw8=RG&[(4v9dg/eaԋ~:sƥVLR':IAyL+C߁fkK OjS݈ l\1-] {1jh"3/+y >s̀ !A<حD*`93j,ﲳA{BVo7ԊI<)j@Tf͙ƲHŶ(Uja?|@$m>Yq_/>Ն'gW*wЈuw&fHa9V4]􍇧̃<4 h1o;ΞsQXџ!~*=]R x,ɩZi[,byudLtJ<\=9g w⮜[ SneX.tjў!99)8$u rF\2g翍? ,`w3;\ p6ᧃd2`*6qC[%ˑyOG+5U2@30usage: %s [-eiuy] [-l blocks] [-c cylinders -h heads -s sectors] [-f mbrfile] disk -i: initialize disk with virgin MBR -u: update MBR code, preserve partition table -e: edit MBRs on disk interactively -f: specify non-standard MBR template -chs: specify disk geometry -l: specify LBA block count -y: do not ask questions `disk' may be of the forms: sd0 or /dev/rsd0c. Cylinder argument %s [1..262144].Head argument %s [1..256].Sector argument %s [1..63].Block argument %s [1..%u].ieuf:c:h:s:l:yPlease specify a full geometry with [-chs].Can't get disk geometry, please use [-chs] to specify.using builtin MBRUnable to read MBRerror initializing MBROffset: %lld Enter 'help' for informationfdisk:%c%d> Invalid command '%s'. Try 'help'. Aborting changes to current MBR.Do you wish to write new MBR?Do you wish to write new MBR and partition table?Command help listShow entire OpenBSD man page for fdiskreinitRe-initialize loaded MBR (to defaults)setpidSet the identifier of a given table entryEdit current drive statseditEdit given table entryflagFlag given table entry as bootableUpdate machine code in loaded MBRSelect extended partition table entry MBRSwap two partition entriesPrint loaded MBR partition tablewriteWrite loaded MBR to diskexitExit edit of current MBR, without saving changesQuit edit of current MBR, saving current changesabortAbort program without saving current changes%s: [%u] %s is out of range: %c%s%c %s is invalid: %c%s%c %s [n] Partition id ('0' to disable) [%X - %X]: [%X] (? for help) '%s' is not a valid number. '%x' is out of range. %s [%d - %d]: [%d] %s is %s: %s. BytesSectorsKilobytesMegabytesGigabytesDisk: %s geometry: %d/%d/%d [%.0f %d-byte %s] geometry: %s is not a character device or a regular fileDIOCGPDINFOdisk too large (%llu sectors). size truncated.Signature: 0x%X Start of partition #%d after end! Starting Ending LBA Info: #: id C H S - C H S [ start: size ]-------------------------------------------------------------------------------%c%1d: %.2X %6u %3u %3u - %6u %3u %3u [%12u:%12.0f%s] %s Warning CHS values out of bounds only saving LBA valuesChoose from the following Partition id values:%02X %s %02X %s %02X %s %02X %s partition number is %s: %s. flag value is %s: %s. Partition %d marked active. Partition %d flag value set to 0x%x. %s %s Machine code updated.partition number is invalid:partition number is %s: %s %d same partition as %d, doing nothing. MBR contains more than one OpenBSD partition!Write MBR anyway?Writing MBR at offset %d. error writing MBROffset: %d Partition %d is not an extended partition. Loop to offset 0! Not selected.Selected extended partition %d New MBR at offset %d. Change disk geometry?BIOS CylindersBIOS HeadsBIOS SectorsPartition %d is disabled. Do you wish to edit in CHS mode?BIOS Starting cylinderBIOS Starting headBIOS Starting sectorBIOS Ending cylinderBIOS Ending headBIOS Ending sectorPartition offsetPartition sizeIn memory copy is initialized to:Use 'write' to update disk.(invalid file type(standard input)(fd %d)usage: %s [-abcEFGHhIiLlnoqRsUVvwx] [-A num] [-B num] [-C[num]] [-e pattern] [-f file] [--binary-files=value] [--context[=num]] [--line-buffered] [pattern] [file ...] ^\((%s[[:<:]]%s%.*s%s[[:>:]]%scontext out of rangegrep version %u.%u binarywithout-matchtextUnknown binary-files optionCan't use small fgrep with -wbinary-filesmmapline-bufferedafter-contextbefore-contextextended-regexpfixed-stringsbasic-regexpwith-filenamebyte-offsetregexpno-filenameignore-casefiles-without-matchfiles-with-matchesline-numberquietsilentrecursiveno-messagesrevert-matchword-regexpline-regexpunix-byte-offsets0123456789A:B:CEFGHILRUVabce:f:hilnoqrsuvwxyLine is too big to processBinary file %s matches usage: %s %s umount [-fv] special | nodeumount -a [-fv] [-h host] [-t type]%s: not currently mounted%s: not a directory or special device%s: unmount from %s afh:t:vmainiieiiii:iij jr@usage: mount_msdos [-9lsx] [-g gid] [-m mask] [-o options] [-u uid] special node invalid file mode: %sunknown user id: %sunknown group id: %ssl9xu:g:m:o:stat %snot an MSDOS filesystemcheckfsfsck_%snostart %s %swait %s%s/fsck_%sexec %sCan't get resource limit to max data sizeCan't get resource limit for data size-b %sInvalid option stringusage: %s [-dfnpvy] [-b block#] [-l maxparallel] [-T fstype:fsoptions] [-t fstype] [special | node ...] dvpfnyb:l:T:t:%s: unknown special file or file system.Can't open checklist file: %s/etc/fstabpass %d, name %s BAD DISK NAME %s %s in fstab more than once!disk %s: Unknown pid %lddone %s: %s (%s) = %x %s: %s (%s): EXITED WITH SIGNAL %d THE FOLLOWING FILE SYSTEM%s HAD AN %s UNEXPECTED INCONSISTENCY:%s: %s (%s)%s, )c]!!\cX%`-V%`,i\1Sn6i!XfffffffffffffffffffffffffffffffmRQw }dNfev_gY&V0V$xYMuAAM pywy@so+lRJ'x/C/=M+ O$+malloc %zuuntrusted comment: invalid comment in %s; must start with '%s'comment too longmissing new line after b64 in %sinvalid b64 encoding in %sEdunsupported file %sdup failedcan't open %s for %sread from %susage: %1$s -V [-eq] [-x sigfile] -p pubkey -m message CGISVc:em:np:qs:x:must specify sigfile with - message%s.sigpath too longneed message and pubkeyfstat on %s%s must be a regular filemsg too large in %sverification failed: checked against wrong keysignature verification failedwrite to %susage: %s [-m mode] fifo_name ... usage: %s [-m mode] name b|c major minor %s [-m mode] name p node must be type 'b' or 'c'.non-numeric major number.non-numeric minor number.major or minor number too largemkfifoinvalid file mode.m:sodumpinet6_makenetandmaskgetaddrprint_rtmsgmonitorH@GT@H@`@P?P?P?h@h@h@ذTp@netname6routenamep_flagsp_rtentry0123456789abcdefUGHRBD M@dmCXLS1@2 3cPTdefaultconnectedstaticospfis-isbgpbad label: %s is %sinvalid table id: %slabel too longprefixlen is not supported with af %dprefixlen %s is %s%s: link %s; %s: inet %s; %s: inet6 %s; set_metric mtu: %s is %sset_metric expire: %s is %sking bula sez: set_metric with invalid key128internal error%s: resolved to multiple valuesmpls labels require -in or -out switch%s: not a network%s: bad address%d: bad address familybotched keyword: %susage: %s [-dnqtv] [-T tableid] command [[modifiers] args] commands: add, change, delete, exec, flush, get, monitor, show setrtable sockaddrs: locks: inits: route to: %s routing message version %d not understoodmessage length mismatch, in packet %d, returned %dRTM_GET: %s (errno %d)destination: %s mask: %s gateway: %s interface: %.*s if address: %s mpls label: %s %s priority: %u (%s) flags: label: %s use mtu expire%8llu %8u%c %8lld%c sockaddrs: [rtm_type %d out of range]: len %d, if# %d, name: %s, link: %s, flags:, metric %d, flags:, if# %d, name %s, what: arrivaldeparture, priority %d, table %u, pid: %ld, seq %d, errno %d flags: use: %8llu mtu: %8u%c expire: %8lld%cso_dstso_gateso_maskso_ifpso_ifaso_labelso_srcwriting to routing socketread from routing socketmust be root to alter routing table-mplslabel requires -inet or -inet6-in requires -mpls-out requires -mpls-out requires -push, -pop, -swap-pop requires -mpls-push requires -mpls-swap requires -mplspriority is %s: %snetmask missingnet: gateway %sentry in userouting table overflownot in tableroute-sysctl-estimateactual retrieval of interface tablesetsockopt(ROUTE_MSGFILTER)setsockopt(ROUTE_TABLEFILTER)got message of size %d on %sno such interface %sactual retrieval of routing tableExamining routing table from sysctl(address family %s) write to routing socketgot only %d for rlen %-20.20s donednqtT:vrouting table %d/dev/nulladdblackholechangecloningdstencapexpiregatewaygethopcountifaifpjumbolinkllinfolockrestmpathmplslabelnojumbonostaticpopproto1proto2pushrecvpiperejectrttrttvarsasendpipeshowssthreshxresolveRTM_ADD: Add RouteRTM_DELETE: Delete RouteRTM_CHANGE: Change Metrics or flagsRTM_GET: Report MetricsRTM_LOSING: Kernel Suspects PartitioningRTM_REDIRECT: Told to use different routeRTM_MISS: Lookup failed on this addressRTM_LOCK: fix specified metricsRTM_OLDADD: caused by SIOCADDRTRTM_OLDDEL: caused by SIOCDELRTRTM_RESOLVE: Route created by cloningRTM_NEWADDR: address being added to ifaceRTM_DELADDR: address being removed from ifaceRTM_IFINFO: iface status changeRTM_IFANNOUNCE: iface arrival/departureRTM_DESYNC: route socket overflowPUSHLOCALPOPSWAPlink#%dillegal prefixlen%s/%d%u/%d%u.%u/%d%u.%u.%u/%d%u.%u.%u.%u/%daf %d: %s(%d) %s%-6s %-*.*s %-6u/esp/ah/ipcomp/ipip//use/require/acquire/deny/bypass/dontacq//in/out%-*s %-5u %-*.*s %-5u InternetInternet6Encap Protocol Family %d: MPLS%-18s %-5s %-18s %-5s %-5s %-22s SourcePortProtoSA(Address/Proto/Type/Direction)%-9s %-9s %-6s %-18s %-6.6s %5.5s %8.8s %5.5s %4.4s %s In labelOut labelOpGatewayFlagsRefsUseMtuPrioInterface%-*.*s %-*.*s %-6.6s %5.5s %8.8s %5.5s %4.4s %sIfaceLabel%-6.6s %5u %8llu %5u %5s %2d %-5.16ssysctl of routing tableRouting tablesspd-sysctl-estimatesysctl of spd Encap:Extra `@' characters in usernames and passwords should be encoded as %%40 KMGTPftp://http://file::/Can't allocate memory for URL decoding <>"#{}|\^~[]`receivedCan't allocate memory to parse URLurl_get: Invalid URL '%s'No `/' after host (use -o): %sNo filename after host (use -o): %sNo filename after directory (use -o): %sCan't allocate memory for proxy URL.Malformed proxy URL: %serror in base64 encodingCan't open file %sCan't open %sCan't allocate memory for transfer bufferWriting %sReading from file(unknown)Trying %s... r+Requesting %sCan't allocate memory for URL encoding%%%02x (via %s) GET %s HTTP/1.0 Proxy-Authorization: Basic %s%s %s User-Agent: OpenBSD ftpGET %s HTTP/1.0 %s%s GET /%s %s Host: HTTP/1.0Can't allocate memory.[%s]:%s %s%s Writing HTTP requestReceiving HTTP replyError retrieving file: %sToo many redirections requestedContent-Length: Location: Relative redirect not supportedCannot allocate memory for URLRedirected to %s Reading from socketRead short file. Auto-login using ftp URLs isn't supported when using $ftp_proxyImproper response from %sftp_proxyhttp_proxyCan't allocate memory for auto-fetch.Invalid URL: %sCan't connect or login to host `%s'*?[]{}NLSTRetrieving %s/%s mget file fetch aborted. http fetch aborted. Forced abort. The connection will be closed. local: %srunique: can't find unique file name. receive aborted waiting for remote to finish abort. acceptsetsockopt TOS (ignored)%c%c%c421 Service not available, remote server has closed connection. Lost control connection for abort.%cABOR No control connection for command.QUITRETRSTOUSTORPASVproxy server does not support third party transfers. No primary connection. PORT %slocal: %s remote: %s use of scoped address can be troublesomeEPSVwrong server: return code must be 229 LPSVPassive mode refused. Passive mode AF mismatch. Shouldn't happen! wrong server: return code must be 227 %u,%u,%u,%u,%u,%uPassive mode address scan failure. Shouldn't happen! wrong server: return code must be 228 %u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u,%u%c%c%c%d%cparse error! setsockopt (reuse address)setsockopt IP_PORTRANGE (ignored)setsockopt IPV6_PORTRANGE (ignored)listenEPRT |%d|%s|%s|PORT %d,%d,%d,%d,%d,%dLPRT %d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%d,%dlocal: %s remote: %s REST %lldnetin: %slocal: %s: %s%s: short writeWARNING! %d bare linefeeds received in ASCII mode. File may not have transferred correctly. Can't change modification time on %s to %sftpgatehttp%s: bad port number `%s'connect to address %sfdopen failed.Connected to %s. usage: %s [-o output] ftp://[user:password@]host[:port]/file[/] ... %s [-o output] http://host[:port]/file ... %s [-o output] file:file ... %s [-o output] host:/file[/] ... FTPSERVERPORTFTPMODEpassivegateunknown FTPMODE: %s. Using defaultsgate-ftpFTPSERVERNeither $FTPSERVER nor $GATE_SERVER is defined; disabling gate-ftpdumbemacssukeep alive amount is %s: %sretry amount is %s: %s46AaCc:dD:Eegik:mno:pP:r:S:s:tvVnmap: unbalanced brackets. CWD %sCWD command not recognized, trying XCWD. XCWD %scan't get cwdSkipping non-relative filename `%s' a+winternal error: unknown type %d.TYPE %s %sTYPE %susage: %s [ | Using %s mode to transfer files. %s: unknown mode. asciiebcdictenex%lld byte%s %s in %.2f seconds (%.2f %sB/s) ETA: %02d:%02d:%02d %-*.*s%s %-*.*s%s %3d%% %3d%% |%.*s%*s|************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************* %5lld %c%c %2d:%02d:%02d --:-- ETA - stalled -%02d:%02d ETAUnable to determine real path of `%s'%s: not foundunable to create temporary file: %sftpXXXXXXXXXXLISTcan't find list of remote files, oops. can't find list of remote files, oops.anonymous%s@Name (%s:%s): Name (%s): USER %sPassword:PASS %sAccount:ACCT %sLogin %s failed.Already connected to %s, use close first. gateserver not defined (shouldn't happen)PASSERVE %sConnected via pass-through server %s non-printstreamSYSTRemote system type is %s. 215 UNIX Type: L8215 TOPS20Remember to set tenex mode when transferring binary files from this machine. SIZE %sMDTM %s191Y2K warning! Fixed incorrect time-val received from server. %*s %04d%02d%02d%02d%02d%02dCan't convert %s to a time. t $ , 4 <tDLiXusage: %s [-a arch] [-e entry] [-l loadaddr] [-n name] [-o os] [-t type] infile outfile arch is one of:os is one of:%s: invalid elf, not 32 or 64 bita:e:l:n:o:t:unknown arch '%s' unknown OS '%s' unknown type '%s' alphaamd64i386m68kmipsmips64powerpcsparcsparc64superhLinuxstandalonescript%s unable to seek to section header%s: read section headersunexpected segment type %#xesymval and vaddr mismatch %lx %lx mainusage: %s [-dn%sq] dlnpqhalted (with powerdown) by %shalted by %srebooted by %s~SIGTSTP init/etc/rc/dev/consolerevokesetsidopenSIGTERM processesWARNING: some process(es) wouldn't die(can't restart init): mainiieiiii:iijr@T j(Hqrusage: mount_ffs [-o options] special node filesystem must be mounted read-only; you may need to run fsckreload59d"l|L ' GX &;o#U$L , 4 @!LPT0``nFlplllllllln]n n,08nDnTd]]0(@Pd0n l,l8<Tlllnll004PTnd]|n<<<nl n n0lHlTl`lllxlllln<<<< <$<0<<lH<X<d<p<|<<<<<<<<<<<< <<$<0<<<H<T<`<l<x<<<<<<<<<< <<$<0<<<H<T<`<l<x<<<<<<<<<<<<<n(<4<@<L<X<dl<<<<<<<<<<<<<<(<4<@<L<X<d<p<|<<<<<<<<<<<< <<$<0<<<H<T<`<l<x<<<<<<<<<<<<<< <,<8<D<P<\<h<t<<<<<<<<<<<<<<<(<4<@<L<X<d<p<|<<<<<<<<<<<< <4<@<Ln`<l<x8/etc/resolv.confCouldn't open '%s': %sCouldn't write contents to '%s': %sShort contents write to '%s' (%zd vs %zd)fchmod(fd, 0x%x) of '%s' failed (%s)fchown(fd, %d, %d) of '%s' failed (%s)warning: hostname %s contains an underscore which violates RFC 952write_file: path too long (%zu)write_file: imsg_composev: %swrite_fileInvalid option name: '%s'fcntl F_GETF: %sfcntl F_SETFL: %sUnable to clone leaseUnable to apply defaultssearch %s no memory for domainnamenameserver %s no memory for nameserver# Generated by %s dhclient no memory for courtesy lineno memory for resolv.conf contentsegresssocket errorno interface in group egress foundioctl SIOCGIFGMEMB: %sget_ifnametoo many interfaces in group egressInterface name too long: %sInterface name too longoption_as_string: bad code %udhcp option too largedaemoncannot forkchdir("/")%s [priv]no memory for priv_ibufpoll error: %simsg_read(priv_ibuf): %sCould not unlink '%s': %s%s; restarting.RESTART FAILED: '%s': %s%s; exiting bootp; %s { %s interface "%s"; fixed-address %s; next-server %s; filename server-name option %s %s; renew %w %Y/%m/%d %T UTC; rebind %w %Y/%m/%d %T UTC; expire %w %Y/%m/%d %T UTC; } offeredcannot fit offered lease into option dbcannot make offered lease into stringeffectivecannot fit effective lease into option dbcannot make effective lease into stringlease file not opencannot make lease into stringoptions do not fit in DHCPDECLINE packet.options do not fit in DHCPREQUEST packet.options do not fit in DHCPDISCOVER packet.DHCPDECLINE on %s to %s port %huNo acceptable DHCPOFFERS received.Trying recorded lease %sbound: renewal in %lld seconds.bound: immediate renewal.No working leases in persistent database - sleeping.DHCPDISCOVER on %s to %s port %hu interval %lldDHCPREQUEST on %s to %s port %hudhcpoffer: no memory to record lease.option-dhcpoffer: unknown option %dBogus data for option %sdhcpoffer: no memory for server name.Bogus server name %sdhcpoffer: no memory for filename.bound to %s -- renewal in %lld seconds.Unsatisfactory %susage: %s [-dqu] [-c file] [-i options] [-L file] [-l file] interface No memory for rtmmsg%s sa == NULL%s, not %s, added to %s%s added to %sActive address (%s) deleted; exiting%s, not %s, deleted from %s%s deleted from %s%s downLLADDR changed; restarting%s departuredno memory for errmsg'%s' is not a regular filec:di:l:L:quifi callocclient callocconfig calloc%s.%s/var/db/dhclient.leasesasprintfsetting routing table to %u: '%s'/etc/resolv.conf.tailCannot open /etc/resolv.conf.tail: %sCannot stat /etc/resolv.conf.tail: %sno memory for resolv.conf.tail contents: %sCouldn't read resolv.conf.tail: %sGot no data from resolv.conf.tailShort read of resolv.conf.tail%s: no link ... sleeping got link cannot open %s: %s_dhcpno such user: _dhcpsocketpair: %sno memory for unpriv_ibufcan't open and lock %s: %scan't open %s: %ssocket(PF_ROUTE, SOCK_RAW): %ssetsockopt(ROUTE_MSGFILTER): %ssetsockopt(ROUTE_TABLEFILTER): %s/var/empty/chrootsetresgidsetgroups/etc/dhclient.confno memory for reject address!expecting option name.too many options.expecting hex octet.string constant too long.expecting string or hexadecimal dataexpecting ':'.expecting identifier after option keyword.unknown option name.expecting string.option data buffer overflowexpecting signed 32-bit integer.expecting unsigned 32-bit integer.expecting unsigned 16-bit integer.expecting unsigned 8-bit integer.expecting identifier.truefalseexpecting boolean.Bad format %c in parse_option_param.out of memory allocating option data.expecting interface name (in quotes).wrong interface name.expecting lease declaration.expecting left brace.no memory for lease.unterminated lease declaration.Obsolete client identifier (%s) in recorded leaseexpecting a statement.unterminated interface declaration.Corrupt lease file - possible data loss!getifaddrs failedinterface %s already has the offered subnet!Can't create socketinterface_link_forceup: SIOCGIFFLAGS failed (%s)interface_link_forceup: SIOCSIFFLAGS DOWN failed (%s)interface_link_forceup: SIOCSIFFLAGS UP failed (%s)receive_packet failed on %s: %sInterface %s no longer appears valid.no space to remember ifpNo interfaces availableInterface %s: rdomain changed out from under usNo live interface to poll onpoll: %sdispatch%s; restartingsend_packet: %ssocket(SOCK_RAW): %ssetsockopt(IP_HDRINCL): %ssetsockopt(SO_RTABLE): %s/dev/bpf%dCan't find free bpf: %sCan't attach interface %s to bpf device %s: %sCan't get BPF version: %sKernel BPF version out of range - recompile dhcpd!Can't set immediate mode on bpf device: %sCan't set filter-drop mode on bpf device: %sCan't get bpf buffer length: %sCan't allocate %lu bytes for bpf input buffer.Can't install packet filter program: %sCan't install write filter program: %sCannot lock bpfcSc"'$`\\%cpretty_print_option: bad code %d%s: Excess information in format string: %s%s: no size indicator before A in format string: %s%s: garbage in format string: %s%s: expecting at least %d bytes; got %d%s: expecting only %d bytes: got %d%s: expecting %d bytes: got %d%s/%uUnexpected format code %coption %s (%d) larger than buffer.option %s has no length field.Can't allocate storage for option %s.Can't expand storage for option %s.DHCPACKDHCPOFFERDHCPNACKBOOTREPLY%s from %s (%s)no memory for info stringeof in string constantstring constant too longnumeric token larger than internal bufferappendbackoff-cutoffbootpdenyethernetfixed-addresshardwareignoreinitial-intervallink-timeoutmediumnext-serverprependrebindrenewrequireretryselect-timeoutsendserver-namesupersedetimeout%s line %d: %s%*c^ %s: msgbuf_write: %sRTM_DELETE write: %sshort RTM_DELETE write (%zd) DHCLIENT DHCLIENT %dcreating route label: %screating route label: label too long (%d vs %zd)default route socket: %sRTM_GET of default route: %sget default route read: %sno data from default route readdefault route read rtm: %ssendhup: imsg_compose: %ssendhupadd_address: imsg_compose: %sadd_addressdelete_address: imsg_compose: %sdelete_addressadd_route: imsg_compose: %sadd_routeflush_routes: imsg_compose: %sflush_routessocket open failed: %sSIOCAIFADDR failed (%s): %sSIOCDIFADDR failed (%s): %sdelete_addresses getifaddrs: %sRouting Socket open failed: %sfailed to add default route: %sroutes buf malloc:sysctl retrieval of routes:route cleanup failed - %s %s (msize=%zu)opening socket to flush routes: %ssysctl size of routes:%d bad IP checksums seen in %d packets%d udp packets in %d too long - dropped%d bad udp checksums in %d packetspadsubnet-masktime-offsetIAtime-serversien116-name-serversdomain-name-serverslog-serverscookie-serverslpr-serversimpress-serversresource-location-servershost-nameboot-sizemerit-dumpdomain-nameswap-serverroot-pathextensions-pathip-forwardingnon-local-source-routingpolicy-filterIIAmax-dgram-reassemblydefault-ip-ttlpath-mtu-aging-timeoutpath-mtu-plateau-tableSAinterface-mtuall-subnets-localbroadcast-addressperform-mask-discoverymask-supplierrouter-discoveryrouter-solicitation-addressstatic-routestrailer-encapsulationarp-cache-timeoutieee802-3-encapsulationdefault-tcp-ttltcp-keepalive-intervaltcp-keepalive-garbagenis-domainnis-serversntp-serversvendor-encapsulated-optionsnetbios-name-serversnetbios-dd-servernetbios-node-typenetbios-scopefont-serversx-display-managerdhcp-requested-addressdhcp-lease-timedhcp-option-overloaddhcp-message-typedhcp-server-identifierdhcp-parameter-request-listBAdhcp-messagedhcp-max-message-sizedhcp-renewal-timedhcp-rebinding-timedhcp-class-identifierdhcp-client-identifieroption-62option-63nisplus-domainnisplus-serverstftp-server-namebootfile-namemobile-ip-home-agentsmtp-serverpop-servernntp-serverwww-serverfinger-serverirc-serverstreettalk-serverstreettalk-directory-assistance-serveruser-classoption-78option-79option-80option-81relay-agent-informationoption-83option-84nds-serversnds-tree-namends-contextoption-88option-89option-90option-91option-92option-93option-94option-95option-96option-97option-98option-99option-100option-101option-102option-103option-104option-105option-106option-107option-108option-109option-110option-111option-112option-113option-114option-115option-116option-117option-118option-119option-120classless-static-routesCIAoption-122option-123option-124option-125option-126option-127option-128option-129option-130option-131option-132option-133option-134option-135option-136option-137option-138option-139option-140option-141option-142option-143tftp-config-fileoption-145option-146option-147option-148option-149voip-configuration-serveroption-151option-152option-153option-154option-155option-156option-157option-158option-159option-160option-161option-162option-163option-164option-165option-166option-167option-168option-169option-170option-171option-172option-173option-174option-175option-176option-177option-178option-179option-180option-181option-182option-183option-184option-185option-186option-187option-188option-189option-190option-191option-192option-193option-194option-195option-196option-197option-198option-199option-200option-201option-202option-203option-204option-205option-206option-207option-208option-209option-210option-211option-212option-213option-214option-215option-216option-217option-218option-219option-220option-221option-222option-223option-224option-225option-226option-227option-228option-229option-230option-231option-232option-233option-234option-235option-236option-237option-238option-239option-240option-241option-242option-243option-244option-245option-246option-247option-248classless-ms-static-routesoption-250option-251autoproxy-scriptoption-253option-254option-endexpecting semicolon.time string too longinvalid time string%w %Y/%m/%d %T UTC%w %Y/%m/%d %T%u %Y/%m/%d %Tunparseable time stringtime could not be representedexpecting unsigned 32-bit decimal value.expecting CIDR subnet.expecting '/'.Expecting CIDR prefix length.expecting 'ethernet'.expecting '.'.expecting decimal octet.filename must be a stringno memory for string %s.dispatch_imsg: imsg_get failure: %sbad IMSG_DELETE_ADDRESSbad IMSG_ADD_ADDRESSbad IMSG_FLUSH_ROUTESbad IMSG_ADD_ROUTEbad IMSG_HUPshort IMSG_WRITE_FILEbad IMSG_WRITE_FILE (%zu)received unknown message, code %ucannot close temp fileinvalid address/tmp/ed.XXXXXXXXXXw+cannot open temp fileline too longcannot seek temp filecannot write temp filecannot read temp fileunexpected end-of-file& no previous commandinvalid pattern delimiter\  \abfnrtv\cannot read stdincannot write filecannot open output filecannot close output filecannot read input filenewline inserted newline appended cannot open input filecannot close input fileshell access restrictedinvalid mark charactered.hup/ed.hupno current filenameinvalid filenamefilename too longno matchnumber out of rangeinvalid command suffixunexpected addressunexpected command suffixinvalid redirectioncannot nest global commandsdestination expectedinvalid destinationno previous substitutioncrypt unavailableHOMEcrypt unavailable ? p:sx ? interrupt? warning: file modifiedscript, line %d: %s usage: %s [-] [-sx] [-p string] [file] unbalanced brackets ([])trailing backslash (\)no previous patterninfinite substitution loopnothing to undocopy_link%s%s: name too long (not copied)%s and %s are identical (not copied).cannot overwrite directory %s with non-directory %s%s is a directory (not copied).HLPRfiprthe -R and -r options may not be specified together.the -H, -L, and -P options may not be specified with the -r option.%s: name too longusage: %s [-fip] [-R [-H | -L | -P]] source target %s [-fip] [-R [-H | -L | -P]] source ... directory lchown: %sutimes: %schown: %schmod: %schflags: %sunlink: %smknod: %smkfifo: %sreadlink: %ssymlink: %soverwrite %s? <LԖ8hؕTX\      A@!  @a`10  @`Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O @@ !1Aa  0@` #+3;CScshxVusage: %s [-123456789cdf%sh%slNnOqrt%sv] [-b bits] [-o filename] [-S suffix] %*s [file ...] usage: %s [-cfh%slNnqrt%sv] [-o filename] [file ...] usage: %s [-f%shqr] [file ...] OK %4.1f%% -- replaced with %s %lld bytes in, %lld bytes out method crc date time compressed uncompressed ratio uncompressed_name%-7.7s %08x %s %10lld %10lld %4.1f%% %s %10lld %10lld %4.1f%% (totals) .-_tgztazfchown: %sfchmod: %sfchflags: %sfutimes: %scompression not supported%s: won't read compressed data from terminal%s: unrecognized file formatcrc errorzcatzipunknown program nameGZIPoption -a is ignored on this systemillegal bit count -- %s-o argument is too long-o option may only be used with a single input filemay not mix -o, -c, or -t options%s is a directory: ignored: unchanged%s not a regular file%s%s already has %s suffix -- unchanged%s: unknown suffix: ignored%s%s: name too long%s: input: %sdeflate.gz123456789ab:cdfhLlNnOo:qrS:tVvcfhLlNno:qrtVvfhqrZgzz1.2.3need dictionarystream endfile errorstream errordata errorinsufficient memorybuffer errorincompatible versionusage: %s [-R [-H | -L | -P]] %s file ... owner[:group]usage: %s [-h] [-R [-H | -L | -P]] %s file ... %s [-h] [-R [-H | -L | -P]] :group file ... group is %s: %suser is %s: %sHLPRXfghorstuwxthe -R and -h options may not be specified together.invalid flags: %sinvalid flag: %smakeentrylinkupfileerrordirscaniblockckinodecheckfilesyspass2pass2checkpass5setup<DP\dl|ذ2n$4 @ catchinfocatchquit?>~*&N>*>N>6^>>>^>6^>>>^*>>*>>.n>>>>*>n>6^>>>^>6^>>>^&66.66&n666>.>nN^^n^^nN^^^~n~N>6^>>>^>6^>>>^>6^>>>^>>>>>>>~>>>>>>~*>>*>>.n>>>>*>n>>>>>>>~>>>>>>~N^^n^^nN^^^~n~NΊΞΊ        @    !     !@%lld %s I=%llubad size: blk %lld, offset %lld, size %d blk %lld < cgdmin %lld; blk + cnt %lld > cgsbase %lld blk %lld >= cgdmin %lld; blk + cnt %lld > sblock.fs_fpg %d cannot allocate memory for inode cache cannot increase directory listbad inode number %llu to nextinode %llu cannot alloc %lu bytes to extend inoinfo CG %d: BAD MAGIC NUMBER %lld files, %lld used, %lld free (%lld frags, %lld blocks, %lld.%lld%% fragmentation) %lld files missing %lld blocks missing %lld,conversion levelcannot do level %d conversion usage: %s [-fnpy] [-b block#] [-c level] [-m mode] filesystem ... dfpnNyYb:c:m:EXCESSIVE DUP BLKS I=%llucannot alloc %u bytes for inoinfobad direct addr: %ld bad indirect addr: %ld INCORRECT BLOCK COUNT I=%llu (%ld should be %d)too many inodes %llu cannot realloc %zu bytes to %zu for inoinfo phase 1, inode %llu/%lluphase 1b, inode %llu/%llu%s %s: LENGTH %ld NOT MULTIPLE of %d%s %s: LENGTH %ld NOT MULTIPLE OF %dphase 2, directory %d/%dphase 2, parent directory %d/%d (REMOVED)phase 3, directory %d/%ldphase 4, inode %llu/%lluDELETING CLUSTERING MAPS DELETE CLUSTERING MAPSCREATCANNOT %s CLUSTER MAPS CREATE CLUSTER MAPS%sING CLUSTER MAPS UNKNOWN ROTATIONAL TABLE FORMAT %d FREE BLK COUNT(S) WRONG IN SUPERBLKSUMMARY INFORMATION BADALLOCATED INODE %ld MARKED FREE ALLOCATED FRAG %ld MARKED FREE BLK(S) MISSING IN BIT MAPSphase 5, cg %d/%d%s: NOT LABELED AS A BSD FILE SYSTEM (%s) NCG OUT OF RANGECPG OUT OF RANGENCYL LESS THAN NCG*CPGSBSIZE PREPOSTEROUSLY LARGEILLEGAL BLOCK SIZE IN SUPERBLOCKILLEGAL FRAGMENT SIZE IN SUPERBLOCKoffset %d, original %ld, alternate %ld VALUES IN SUPER BLOCK DISAGREE WITH THOSE IN LAST ALTERNATEINFORMATION; SEE fsck_ffs(8).clean = %d UNDEFINED OPTIMIZATION IN SUPERBLOCKIMPOSSIBLE MINFREE=%d IN SUPERBLOCKIMPOSSIBLE NPSECT=%d IN SUPERBLOCK (FIXED)INCORRECT BMASK=%x IN SUPERBLOCKINCORRECT FMASK=%x IN SUPERBLOCKINCORRECT BSHIFT=%d IN SUPERBLOCKINCORRECT FSHIFT=%d IN SUPERBLOCKFormat of filesystem is too old. Must update to modern format using a version of fsck from before release 5.0 with the command ``fsck -c 2'' INCORRECT MAXFILESIZE=%llu IN SUPERBLOCKINCORRECT MAXSYMLINKLEN=%d IN SUPERBLOCKINCORRECT QBMASK=%lx IN SUPERBLOCKINCORRECT QFMASK=%lx IN SUPERBLOCKINCONSISTENT CGSIZE=%d INCONSISTENT INOPB=%d INCONSISTENT NINDIR=%d cannot alloc %u bytes for cylinder group summary area cannot alloc %u bytes for inostathead cannot alloc %zu bytes for inpsort cannot alloc %zu bytes for inphead inoinfo: inumber %llu out of rangeCANNOT %s: BLK %lldWRITING %sZERO'ED BLOCK %lld TO DISK UPDATE STANDARD SUPERBLOCK %lld (%lld),   delete %d: %sinsert %d: %ssession database close: %ssession database open: %scannot get kernel security level: %scannot change kernel security level from %d to %d: %sfatal signal: %scan't parse getty for port %scan't allocate windowcan't parse window for port %sport %s changed utmp index from %d to %dcan't fork for window system on port %s: %msetsid failed (window) %mcan't exec window system '%s' for port %s: %mcan't fork for getty on port %s: %mgetty repeating too quickly on port %s, sleepingcan't exec getty '%s' for port %s: %msome processes would not die; ps axl advisedcan't open %s: %mcan't get %s for controlling terminal: %mcannot disable lid suspendcan't exec %s for %s %s: %mautobootcan't exec %s for %s: %mcan't fork for %s on %s: %mwait for %s on %s failed: %m; going to single user modeinit: %s on %s stopped, restarting %s on %s terminated abnormally, going to single user mode/usr/bin:/bin:/usr/sbin:/sbin:/usr/X11R6/bin:/usr/local/bincan't exec %s for single user: %mcan't fork single-user shell, trying againwait for single-user shell failed: %m; restartinginit: shell stopped, restarting single user shell terminated.single user shell terminated, restartinginit: %s init: already running initial setsid() failed: %mrootsetlogin() failed: %munrecognized flag '-%c'sfignoring excess argumentsusage: %s [-b block-size] [-c fragments-per-cylinder-group] [-e maxbpg] [-f frag-size] [-i bytes] [-m free-space] [-o options] [-P file] [-s size] special node usage: %s [-Nq] [-b block-size] [-c fragments-per-cylinder-group] [-e maxbpg] [-f frag-size] [-g avgfilesize] [-h avgfpdir] [-i bytes] [-m free-space] [-O filesystem-format] [-o optimization] [-S sector-size] [-s size] [-T disktype] [-t fstype] special ioctl (WDINFO)%s: can't rewrite disk labelinsane maxpartitions value %dP:T:b:c:e:f:i:m:o:s:NO:S:T:b:c:e:f:g:h:i:m:o:qs:t:%s: invalid ffs versionsector size invalid: %sblock size is %s: %sfragments per cylinder group is %s: %sblocks per file in a cylinder group is %s: %sfragment size is %s: %saverage file size is %s: %saverage files per dir is %s: %sbytes per inode is %s: %sfree space %% is %s: %s%s: unknown optimization preference: use `space' or `time'.file system size invalid: %snewfs_%s%s/newfs_%s%s not found%s: getmntinfo: %s%s: no default sector size%s: maximum file system size on the `%c' partition is %llu sectorswarning: changing optimization to space because minfree is less than %d%% setblock bad fs_frag %dclrblock bad fs_frag %disblock bad fs_frag %dwtfs: write error on block %lldrdfs: read error on block %lldcg 0: bad magic numberfirst cylinder group ran out of spaceinternal error: can't find block in cyl 0ilog2: %d is not a power of 2 fsinit: inode value %llu out of rangeinode table does not fit in cylinder grouppanic: cylinder group too big: %d > %dpreposterous size %lld, max is %dpreposterous size %lld, max is %lldblock size must be a power of 2, not %dfragment size must be a power of 2, not %dfragment size %d is too small, minimum is %lldblock size %d is too small, minimum is %dblock size %d is too large, maximum is %dblock size (%d) cannot be smaller than fragment size (%d)fragment size %d is too small, minimum with block size %d is %ddensity reduced from %d to %d bytes per inodecan't honour -c: minimum is %dfile system size %jd < minimum size of %d fragmentsreduced number of fragments per cylinder group from %d to %d to enlarge last cylinder groupcalloc failed%s: %.1fMB in %jd sectors of %lld bytes %d cylinder groups of %.2fMB, %d blocks, %d inodes each can't get physmemwarning: fsck_ffs will need %lluMB; min(MAXDSIZ,physmem) is %lluMBsuper-block backups (for fsck -b #) at:cannot allocate I/O bufferfsinit1 failedfsinit2 failed%s: initializing cg %ld/%d checkrm_overwriteusage: %s [-dfiPRr] file ... "." and ".." may not be removedremove %s? override %s%s%s/%s for %s? %s (inode %llu): not overwritten due to multiple links%s: malloc%s: is a directorydfiPRrusage: %s [-t] device usage: %s [-f device] command [count] %d: unknown tape drive type %s tape drive, residual=%d erblocksize: %d (%d) density: %d (%d) ioctl MTIOCGETf:no remote support%s: unknown command%s: illegal countbsfbsrdensityeomfsffsrofflinerewindrewofflretensionweofWriteProtectMounted76543210usage: %s [-p] [-m mode] directory ... m:p\ can not be used as a string delimiternewline can not be used as a string delimiterwhitespace after %sundefined label '%s'RE error: %sunterminated regular expressionexpected context addressunexpected EOF (pending }'s)0123456789/\$command expectedinvalid command code %ccommand %c expects up to %d address(es), found %dunexpected }extra characters at the end of %c commandcommand %c expects \ followed by textextra characters after \ at the end of %c commandfilename expectedw commandread commandbranchempty labelduplicate label '%s'substitute pattern can not be delimited by newline or backslashunterminated substitute pattern123456789\%c not defined in the REunescaped newline inside substitute patternunterminated substitute in regular expressionmore than one number or 'g' in substitute flagsnumber in substitute flags out of rangeno wfile specifiedbad flag in substitute command: '%c'transform pattern can not be delimited by newline or backslashunterminated transform source stringunterminated transform target stringtransform strings are not the same lengthextra text at the end of a transform commandunused label '%s' ..."usage: sed [-aEnru] command [file ...] sed [-aEnru] [-e command] [-f command_file] [file ...] Eae:f:nrustdout: %ssed: %lu: %s: first RE may not be empty\ %03o\%d not defined in the RE\abfrtvXb XX} X|u u Xh X XV X_ XY X` 8u X{ Xh Yh YXa Y4q Y^ $Y^ U (Y0Yc_umask[ [ [L [ [ ([ 4[x <[L D[ L[ T[ `[ h[ p[ x[L [ [$ [L [ [ [ [̌ U [ 4en-a-b-c-d -e-f-G-g-h -H -k-L -n-O-o-p -r-s-S -t-u-w-x-z===!=<>-eq-ne-gt-ge-lt -le!-ef"-nt#-ot$0o|\04,e]t,]f<]cP]d`]sp]l]m]npx_modex_search_histkb_addx_bindx_emacs  ^ ^< ^| ^ _ _@ 8_ L_ `_ l_ t_@ 0\ l{ _h  _T _ ^X _ _ _ _ _| _ _, `8 `P 0`t <`P L` \`p d` t` ` `8 `X ` ` ` ` a| a( a d7 ,aH ^ Da Ta `a pa ap a adbteste_isaxd++--==!== *= /= %= += -= <<= >>= &= ^= |= <<>><=>=<>&& || */%+-&^|? , ~!():hist_initj_printܥkkkdoppromptyylexIFS= ${PS2=> } ${PS3=#? } ${PS4=+ }lmxdLwhmdcgmatchgetoptionsoaoocoopepppi(pk0pl8pX?mDpCrnPpfXp`phbhpupp|pppcrE0 sph4\vnpppppxdo_phys_pathshf_vfprintffsssss s Ts (< s ss$t^rs{]}0ssssss\` RRRRR]]<>!let||&&()str_valA ]wLw w4Le 0w $  \l?[\]`{|};|&()`+@!fileglob: substitute errorFPATH nothing to yank yank something first I-search: duplicate binding for %sPOSIX%s = %s %s = '%s' cannot bind, not a ttyauto-insert%s: no such functioninvalid return codebeginning-of-historycomplete-commandcomplete-filecompletedelete-char-backwarddelete-word-backwarddelete-char-forwarddelete-word-forwardkill-lineredrawend-of-historyeot-or-deletegoto-historymacro-stringkill-to-eolkill-regionlist-commandlist-filequoteyank-popbackward-charbeginning-of-linebackward-wordend-of-lineforward-charforward-wordnewlinedown-historynewline-and-nextno-opup-historyprev-hist-wordsearch-character-forwardsearch-character-backwardsearch-historyset-mark-commandstuffstuff-resettranspose-charsexchange-point-and-markcomplete-listexpand-filecapitalize-worddowncase-wordupcase-wordset-argcomment*+?@! substituteexpand(NULL)%Rfunny $() command: %s%s: cannot open $(<) input%s: parameter not set%S%s: bad substitutionparameter null or not set%*d) %sdbteste_error: %s (offset %d)shcomexec: %shere document missingcan't %s temporary file %s: %sherein: yylexerror writing %s: %sPS4%s%s %s: restricteddupcannot %s %s: %scould not finish (dup) redirection %s: %scoprocess already existsPS3EXECSHELL%s: %s: %sbuiltin: %s: not a builtincommand -p: restricted%s: can't find function definition file - %s%s: can't find function definition file%s: can't open function definition file %s - %s%s: function not defined by %sCFUNC %d%s: cannot execute - %s-rend of expression%s: unexpected `%s'%s: bad number `%s'%s: expression recurses on parameter `%s'%s: %s requires lvalue%s: %s applied to read only variablemissing )zero divisormissing :HISTFILE%s.%dno history (yet)%s: not in history%s: invalid rangehistory functions not available-%c%se:glnrs0,1,2,3,4,5,6,7,8,9,can't use -e, -l, -n, -r with -s (-e -)substitution failedcan't use -l, -n with -e-16%.*s cannot create temp file %s - %serror writing temporary file - %s${FCEDIT:-/bin/ed} $_cannot open temp file %serror reading temp file %s - %sno coprocess%s/shXXXXXXXXbad file descriptorfd not open for readingfd not open for writingillegal file descriptor name%s[%d]: internal error: shl_stdout not validtoo many files open in shellcan't create pipe - try again RunningDoneDone (%d)[%d] %c %5d (core dumped)%s%s %-20s %s%s%s%s%5d %-20s %s%s %s%sremove_job: job not found (%s)notifyj_async: job not startedj_async: bad nzombie (%d)zombiejobsstopped and runningYou have %s%s%s jobs j_waitj: tcsetpgrp(%d, %d) failed: %sjob not job-controlled[%d] | 1st tcsetpgrp(%d, %d) failed: %sfg: 2nd tcsetpgrp(%d, %d) failed: %scannot continue job %s: %sjw:resumejw:waitforwaitlast: no last jobwaitlast: not startedjw:waitlastexchild: XPIPEI and no last_job - pid %dfork failedcannot fork - try againchildexchild: execute() returned[%d]jw:last procj_init: getpgrp() failed: %sj_init: tcgetpgrp() failed: %sj_init: setpgid() failed: %sj_init: tcsetpgrp() failed: %swarning: won't have full job controlj_suspend: tcsetpgrp() failed: %sj_suspend: setpgid() failed: %scheck_job: job started (flags 0x%x)checkjobno such jobambiguousargument must be %job or process id%a %b %d%l:%M:%S%r~/%sPS1\$PS2missing ] no closing quote here document `%s' unclosed MAILyou have mail in $_shell: %dUse `exit' to leave ksh include: %drshrkshrpdkshpdrkshSH_VERSIONPPIDUSER$ -c requires an argumentCannot determine current working directory/etc/profile$HOME/.profile/etc/suid_profileENVtypesetKSH_VERSION-xOPTIND=1evaltypeset -i RANDOM MAILCHECK="${MAILCHECK-600}" SECONDS="${SECONDS-0}" TMOUT="${TMOUT-0}"hash=alias -ttype=whence -vstop=kill -STOPautoload=typeset -fufunctions=typeset -fhistory=fc -linteger=typeset -inohup=nohup local=typesetr=fc -e -login=exec login-tUccmailmakeprviwho |&;<>()*@#!$-? =-+?#% "#$&'()*;<>?[\`|0123456789ABCDEF%-*s%*s'\'%s%s-%c: unknown option%s%s-`%c' requires argument%-*s %sA:o;sCurrent option settings -o %s%s: bad optionparse_args: `%c'allexportbraceexpandbgnicecsh-historyemacs-usemetaerrexitgmacsignoreeofinteractivekeywordloginmarkdirsnoclobbernoglobnohupnolognounsetphysicalposixprivilegedtrackallvirawvi-show8vi-tabcompletevi-esccompletextracealnumblankcntrldigitgraphlowerpunctupperxdigitshf_flush: no fdshf_emptybuf: no fdshf_write: flags %xshf_write: nbytes %dshf_putchar: flags %xshf_putchar: no fd0123456789abcdef(null %s)shf_ungetc: flags %xshf_fillbuf: no fdshf_getchar: flags %xshf_getse: flags %xshf_read: flags %xshf_read: bsize %dshf_sopen: flags 0x%xshf_snprintf: buf %lx, bsize %dshf_reopen: missing read/writeshf_reopen: bad shf/buf/bsizeshf_fdopen: missing read/writeunmatchedsyntax error: unexpected EOF ?%dsyntax error: `%s' %s unexpectedtoo many <<'s too many redirections for%s: bad identifier %s: invalid function name thenelseelifficaseesacwhileuntildo{[[&&||;;((|&too many varssetexecsig: unset signal %d(%s)ERRError handlerEXITtimed out waiting for inputSIGwdscan: unknown char 0x%x (carrying on)%S #no-vars# #no-args# ( %T) %T| %T%;%T%s %T %S ]] select %s for %s in %;do%N%T%;done case %S in%N(%S%c%;%T%N;;%Nesac if %Tthen%N%Telif %Telse%;%T%;fi %s %T%;do{%;%T%;} %T|& %T& function %s %T%s() %Ttime %T< <<- << >> >| <> <&>&No controlling tty (open /dev/tty: %s)Can't find tty file descriptorj_ttyinit: dup of tty fd failed: %sj_ttyinit: can't set close-on-exec flag: %s%0*s%.*s%*s%.*s%s: subscript %ld out of range%s: is read onlysetstr: %s=%s: assigning to self0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZ0123456789abcdefghijklmnopqrstuvwxyzOPTINDPOSIXLY_CORRECTHISTSIZEMAILCHECKMAILPATHRANDOMSECONDSTMOUTLINENOM-grabhist: bad history arrayy$%s %dfc -e ${VISUAL:-${EDITOR:-vi}} --derive_key_pkcsbio_diskinqbio_createflagsbio_parse_devlistbio_changepassbio_deleteraidbio_createraidbio_blinkbio_getvolbynamebio_alarmbio_inqstr2locatorbio_setblinkbio_setstatemainInvalid keyInvalid saltToo few rounds: %dcan't specify passphrase file during initial creation of crypto volumeinvalid passphrase filecan't stat passphrase filepassphrase file must be owned by rootpassphrase file has the wrong permissionscan't read passphrase fileinvalid passphrase lengthunable to read passphraseRe-type passphrase: Passphrases did not matchpbkdf2 failedinvalid KDF infoinvalid KDF hintKDF hint has invalid sizeunknown KDF type %dnumber of KDF rounds too low: %dDIOCINQ%s: <%s, %s, %s>, serial %s invalid flags listinvalid flag %sinvalid device listcould not open %scould not stat %stoo many devices on device listduplicate device in listNew passphrase: unknown errorBIOCDISCIPLINEOld passphrase: BIOCDELETERAIDno devices specifiednot enough memory for dev_t listunsupported raid levelnot enough disksnot exactly one partitionioctlPassphrase: BIOCCREATERAID/dev/bioCan't locate %s device via %sBIOCBLINKBIOCINQBIOCVOLinvalid alarm function: %sBIOCALARMalarm is currently %s %-11s %-10s %14s %-8s VolumeStatusSizeDevice %d%% done %u secondsScrubbingInvalidOnlineOfflineDegradedBuildingRebuildWTWB%s %u%14llu%11s %-10s %14s %-7s CRYPTO%s%s %11s %-10s %14s %-7s CONCAT%s%s %11s %-10s %14s %-7s RAID%u%s%s %s BIOCDISKFailedHot spareUnused %3u%14skey disk%u:%u.%unoenclunknown serial%11s %-10s %14s %-7s %-6s <%s> %11s %-10s %14s %-7s %-6s '%s' target not specifiedTarget %s: %sDisk %s is not in an enclosureDisk %s does not existinvalid device %sBIOCSETSTATEusage: %s [-hiqv] [-a alarm-function] [-b channel:target[.lun]] [-H channel:target[.lun]] [-R device | channel:target[.lun]] [-u channel:target[.lun]] device %s [-dhiPqsv] [-C flag[,flag,...]] [-c raidlevel] [-k keydisk] [-l special[,special,...]] [-O device | channel:target[.lun]] [-p passfile] [-R device | channel:target[.lun]] [-r rounds] device Invalid RAID levelNumber of rounds is %s: %sa:b:C:c:dH:hik:l:O:Pp:qr:R:svu:need deviceneed -c parameterneed -l parametermust use bio deviceusage: %s seconds do_movemainusage: %s [-fi] source target %s [-fi] source ... directory /bin/cp-PRp%s: waitpid%s: did not terminate normally%s: terminated with %d (non-zero) status/bin/rm-rf%s: remove%s: set owner/group; not setting setuid/setgid%s: set owner/group%s: set mode%s: set flags%s: set timesrename %s to %scannot resolve %scannot rename a mount pointcan't remove %s%s: destination pathname too longeval5syntax error|&=<>+-*/%:()non-numeric argumentdivision by zerousage: %s [-M core] [-N system] M:N:sysctl: KERN_MSGBUFSIZEcouldn't allocate space for buffer datasysctl: KERN_MSGBUFmainusage: %s [-s] [name-of-host] sethostnamegethostname/etc/networks"(ט/Be#D7q/;Mۉ۵8H[V9YO?m^BؾopE[N1$} Uo{t]r;ހ5%ܛ&itJi%O8GՌƝew̡ $u+Yo,-ntJAܩ\SڈvfRQ>2-m1?!'Y= % GoQcpn g))/F '&&\8!.*Zm,M߳ 8ScTs ew< jvG.;5,rdL迢0BKfpK0TQlReU$* qW5ѻ2pjҸSAQl7LwH'Hᵼ4cZų 9ˊAJNscwOʜ[o.h]t`/CocxrxȄ9dnj(c#齂lPyƲ+SrxqƜa&>'!Ǹ}xnO}orgȢ}c ?G5 q}#w($@{2 ˾L*~e)Y:o_XGJDlɼg j;ʄg+rn<6_:OтRQl>+hkAكy!~[/BD7q۵[V9Y?^[1$} Ut]rހܛtiGƝ̡ $o,-tJܩ\ڈvRQ>m1'Y GQcg)) '8!.m,M 8STs e jv.,r迢KfpK£Ql$օ5pjl7LwH'4 9JNOʜ[o.htocxxȄnjlPxqg jgrn<:ORQhك[0.0.0.0127.0.0.1::::1/etc/group/etc/spwd.db/etc/pwd.db/etc/ethers%02x:%02x:%02x:%02x:%02x:%02x  0123456789ABCDEF0123456789abcdefnanNANinfINF(null)bug in vfprintf: bad base HOSTALIASES/etc/hosts;#nameserverlookupypsearchinet4ndots:RES_OPTIONSoptions LOCALDOMAINsearch lookup bind filenameserver 127.0.0.1ASR_CONFIGlookup file %d.%d.%d.%d.in-addr.arpa.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.%x.ip6.arpa.no spacebad domain namedomain name too longbad dlen@BKMGTPE0B%lld%c%lld.%1lld%cimsg_readmsgbuf_write/dev/diskmap%s%s%s%c%s%s%shmac_sha1pkcs5_pbkdf2logout/var/run/utmplogin_protect%s: %s: %m/etc/fbtab/*%s: chmod(%s): %m%s: chown(%s): %m%s: opendir(%s): %m%o%s: bad entry: %s\\#readlabelfsnHpin%s: not a device node%s: couldn't read disklabel%s: bad filesystem type in labellogwtmp/var/log/wtmptgetentTERMCAP/usr/share/misc/termcapTERMPATH.termcap /usr/share/misc/termcapOOPS5MS7) 0w,aQ mjp5c飕d2yҗ+L |~-d jHqA}mQDžӃVlkdzbeO\lcc=  n;^iLA`rqgjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ﾎCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-A1b62S-+ldEw}ZVǖAOIъ OM~-QJ#SpxAaU׮.7׵Y-6]]wll?AԞZ͢$ Faw$eڪ]]FD(koipvk19Z* ,  m86F߲]qTp0ek*1u4yީ%8S1bSWĔՖk1**ykʬHpo].*F6fcTT"eM©g0&):{ϼkZ> 8$,52F*sw1pHkQ6Fzw]cN̵J #pAF]#l8?1(BOgT~yUbL8^#ܖTZ1ObbSyOIV~P-{b-R4٠~^eGnHl/Su6: #jT$+e?yHf'*b#ٽЧ ?&~?$pi;FBzw[keZ~7 Sv8H 3?r$7jnԄYFܨ |OQ;օ U d S - =G\ p&Gw)` /a߫i5&LsZ<#0zMzFM8,9; :R:(q-v,.7/pXqYs3r%w+OQvrtEux܉~OK }!b|tyBxʠz{.lD~m8onlk[wjR1h58ib?mcf+aQ`צedd"fig HINSKyuJcO NZLݘMFGN@E$DD2AsX@*IBCPhTg3U>uW ַVS:R|P~Q9ZS [fYX4])\ZEo^m/_5qϱ٥s\ۼqދ!K7 kfֶԁ-b3Πjp]$^'~*I@VW<âM˟ŏ{ tDCm-@wm.B+(铜>Td"ŀǼϭ~8y$owJ1}05_K^ iϏ은BI#ƈdX܁T̓cQ: rՆ⩗ fn|xK)o%ƭ/3vUuA?)C:|sĵ@͂ Ͳ;bIUeh"׻_HS1޼^Z4eg Wb27_k%8ם(ŊO}do׸Jj3wVcXWP0qB{߭gCru&op-?'Bs ưGz>2[Ȏg; i8P/ _Y=чe:ZO?(3wwXR @hQ+ğH*0"ZOWoI}@mNП5+#*'G| AH=XX?#1jvʬ`p^Y<L~i/{kHwâ hs)aLoD~Pf7VM'(@ﰤ ہg9x+n&;f?/X)T`D1 ߨMߒ.FgTp'Hq/L0UEc?kǃh6ry7]P\@TN%s7@'>$!AxUʰ\3;Y^U~PGl!;b F2ȂpԞ(Q_V:1X: n3 m:@/)IJNv"2x+ٗ Kx.HҥfAj^y9*O]#kM`~b_R 7zFh!1߈Vc0a"j6nS Nr)Υ{t*F8#vufz`rs"WG9^EMvc΍&DAdQy/4Aڱ&S֚E biLQ<6'5P..T&q]w4.6IE? v\[YI>U!lDa>Ԫ΋ϩ7~8A]&nv|oY yKiw\¹9~$ 66nQfq>,o,IӔ 渱{I .H>C-Yn馑gQz tafw0a, Qmpjc5dۈ2yܸو L+~|-dj qHA}mԵQӅlVdkbze\Ocl=c ;n Li^`Agqr<KG k5Blۻ֬@2lE\u ϫ=Y&0Q:Qa!V#Ϻ(_ ٲ $/o|XhLaf-=vAq *q3xɢ4 j m=-dlc\kkQlabe0bNl{WeP|b-I|LeMaX:QΣtԻ0JߥA=ؕפmCij4ngF`D-s3 L_ |Pq<'A  Wh% of a^)ɘИ"רY=. \;l  tҚG9w&sc d; mj>zjZ '}DhibW]egl6qnkv+zZgJoC`֣ѓ~8ORѻgWg?H6K +گ L6JAz``ègU1nFiyaf%oҠRh6 w G"U&/ź; (+Z\j1,ٞ[ޮd°c&ujm 6?rgWJz{+ 8Ҏվ | !Bhݳڃn&[owGwZjpf; \ebiaklE x NT9§g&a`IiGM>nwۮjJZ@ f7;𩼮S޻G0齽ʺŠS0$6TW)#gfz.aJ]h*o+ 7 Z-1A26b+-Sdl}wEVZOAي»IˬO ~M-JQS#xpaA.U7Y-۩6˚w]]llA?Z$㧲F waރ$Ųe]]DFok(vpi91k *Z  ,8mF6]pTqke0*1¶u4%y<8syjHA}X*ݹ1SbSW§ٖծ1k**kypH]oF*.f6TTcMe"¤0g)&Ůޟ:{kZ >8,$5*F21wsHpQkzF6c]wN̵ׄJ# pȄA#]F8l1?(gOB~TUyLbˁ8#^TO1ZbbySIOP~V{-b-4R^~Ge­lHnuS/:6# $Tj?e+y䏼Hf*'˼Ѝb# &??~p$iBF;[wzek~ZS 7H8v ?3$rj7nFY |OQ; U dؓS - \G=&pGw`)/ ai5&sL <:R=Pe6^X7}o5641W0ճ2k3$k%'1&-[#bML"'{ "!$*x(+)`F(> q-q,v.Ț/7pqXsYr3w%vQO+tru՛E~xKO} |b!ytxBz{l.m~Do8nkljw[h1Ri85bcm?a+f`Qeddf"giH IKSNJuyOcN LZMݥFĚGE@ND$A2D@XsBI*CThPU3gWu>V SR:P|Q~Z9[ SYfX]4\)^oEZ_/m5qs<\kg2z &J8 좞V`a/6i\lU,zB\uHƒ=&FW A+Ox]`غ7W>9q߳!7Kk ֩fض-bѠ3pj$]^Ĝ'*~@IWVÕ<ӂMʏş{ Dt͆mC-@mw+B.(>dT"ş~Ϝ8yo$w1J}50K_ ^ϋiBۉI#dXфTQc:r Р fΫnx|)Ko%3/uUv?A)ġ:C|sд@͉ ;IbeU"hH_S1ފZ^ھ4ge ȋbW72%k_ܝ8Ŵ(}OodJֿjw3XcVPW0Bq{gǧurCo&p-?О'sB zGɠ2>[ ;g/P8i_ Y=嗇e:ϏOZw3(?RXw@ Qh+HZ"0*WOIo@}m5N#+'*GA |􏒨HX=#?X1vjʨ`^pYL'!$UxAׯ3\Y;U^GP~b;!lڇF 2p(ԐQV_:X1: 3n :m@I)/NJ2"v+x xKH.jAf^O*9y]#Mk~`bю_޶ Rz7hFм!10cV"ajحn6 SrN){t*8Fv#fu`zrϮsɛW"G9E^vMcD&dA/yQA4S&ֿ EbLil!>aDƋΪ~7A8n&]|vYoᡱ Kyi׫w¡\~9$66 Qnf>q,o,ӹI 散 I{.C>HnY-Qg̰t zfalongjmp botch. inet6_rth_reverseargument buffer overflowunknown/invalid errorno errorinvalid value for ai_flagsname or service is not knowntemporary failure in name resolutionnon-recoverable failure in name resolutionno address associated with nameai_family not supportedai_socktype not supportedservice not supported for ai_socktypeaddress family for name not supportedmemory allocation failureinvalid value for hintsresolved protocol is unknownfstabscanxxswinet_net_ptoninet_net_pton_ipv401234567890123456789abcdef/usr/src/lib/libc/net/inet_net_pton.cn >= 0 && n <= 15n >= 0 && n <= 9assertion "%s" failed: file "%s", line %d, function "%s" assertion "%s" failed: file "%s", line %d %u.%u.%u.%uSHA256EndSHA256DataSHA256FileChunk0123456789abcdefp|^Ȳ,̲Բܲ< (0Signal 0HUPINTILLTRAPABRTEMTFPEKILLBUSSEGVSYSPIPEALRMURGTSTPCONTCHLDTTINTTOUIOXCPUXFSZVTALRMPROFWINCHUSR1USR2THREĺ[:<:]][:>:]]ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789!"#$%&'()*+,-./:;<=>?@[\]^_`{|}~abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789!"#$%&'()*+,-./:;<=>?@[\]^_`{|}~ !"#$%&'()*+,-./:;<=>?@[\]^_`{|}~ ABCDEFGHIJKLMNOPQRSTUVWXYZ0123456789ABCDEFabcdefNULSOHSTXETXEOTENQBELalertBSbackspaceHTtabLFVTvertical-tabFFform-feedCRcarriage-returnSOSIDLEDC1DC2DC3DC4NAKSYNETBCANEMSUBIS4IS3GSIS2RSIS1USexclamation-markquotation-marknumber-signdollar-signpercent-signampersandapostropheleft-parenthesisright-parenthesisasteriskplus-signcommahyphenhyphen-minusperiodfull-stoponetwothreefourfivesixseveneightninesemicolonless-than-signequals-signgreater-than-signquestion-markcommercial-atleft-square-bracketbackslashreverse-solidusright-square-bracketcircumflexcircumflex-accentunderscorelow-linegrave-accentleft-braceleft-curly-bracketvertical-lineright-braceright-curly-brackettildeDEL(0<LXdlx ,nosappndnosappendnoarchnoarchivednoschgnoschangenosimmutablenouappndnouappendnouchgnouchangenouimmutablenodumpnoopaqueBLOCKSIZE%s: unknown blocksizemaximum blocksize is %dG%s: minimum blocksize is 512%ld%s-blocksкԺغܺ  %m/%d/%y%Y-%m-%d%H:%M%I:%M:%S %p%H:%M:%SESTCSTMSTPSTEDTCDTMDTPDTABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/regerrorREG_0x%xREG_NOMATCHregexec() failed to matchREG_BADPATinvalid regular expressionREG_ECOLLATEinvalid collating elementREG_ECTYPEinvalid character classREG_EESCAPEREG_ESUBREGinvalid backreference numberREG_EBRACKbrackets ([ ]) not balancedREG_EPARENparentheses not balancedREG_EBRACEbraces not balancedREG_BADBRinvalid repetition count(s)REG_ERANGEinvalid character rangeREG_ESPACEREG_BADRPTrepetition-operator operand invalidREG_EMPTYempty (sub)expressionREG_ASSERT"can't happen" -- you found a bugREG_INVARGinvalid argument to regex routine*** unknown regexp error code ***/etc/ttyssecurertsctssoftcarwindowttyname_r/var/run/dev.dbPOSIX_V6_ILP32_OFFBIGPOSIX_V7_ILP32_OFFBIG-lpthreadreadpassphrasetcsetattrglob2SHA512EndSHA512DataSHA512FileChunk0123456789abcdefauthunix_createauthunix_create_defaultauth_none.c - Fatal marshalling problemauthunix_create: out of memory plt$0<Tht,@Tlplt$0<Tht,@TlHangupInterruptQuitIllegal instructionTrace/BPT trapAbort trapEMT trapFloating point exceptionKilledBus errorSegmentation faultBad system callBroken pipeAlarm clockTerminatedUrgent I/O conditionSuspended (signal)SuspendedContinuedChild exitedStopped (tty input)Stopped (tty output)I/O possibleCputime limit exceededFilesize limit exceededVirtual timer expiredProfiling timer expiredWindow size changesInformation requestUser defined signal 1User defined signal 2Thread ASTunknown option -- %coption requires an argument -- %cambiguous option -- %.*soption doesn't take an argument -- %.*soption requires an argument -- %sunknown option -- %s/etc/services,/asprintf%h %e %T clnttcp_create: out of memory `b0b1ncdtscsbpxbxfxoxtxdxgetentcgetnext%s.dbtc|:/etc/protocolsSHA1TransformSHA1Padexecvpeexeclpexecleexeclexecvp: : path too long xdr_array: out of memory 8Tp8Xp $RPC: (unknown error code)%s: %s - %s ; errno = %s; low version = %u, high version = %u; why = (unknown authentication error - %d); s1 = %u, s2 = %uRPC: SuccessRPC: Can't encode argumentsRPC: Can't decode resultRPC: Unable to sendRPC: Unable to receiveRPC: Timed outRPC: Incompatible versions of RPCRPC: Authentication errorRPC: Program unavailableRPC: Program/version mismatchRPC: Procedure unavailableRPC: Server can't decode argumentsRPC: Remote system errorRPC: Unknown hostRPC: Port mapper failureRPC: Program not registeredRPC: Failed (unspecified error)RPC: Unknown protocolAuthentication OKInvalid client credentialServer rejected credentialInvalid client verifierServer rejected verifierClient credential too weakInvalid server verifierFailed (unspecified error)perrorxdrrec_create: out of memory   !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~realpathؗҜ<3#I9=D2[%Cod(hinityanMD5Pad0123456789abcdefInfinityNaNР^[Yy]^[Nn]yes646NONEUTF8 $(,048<@DHLT`h,pxĺSunMonTueWedThuFriSatSundayMondayTuesdayWednesdayThursdayFridaySaturdayJanFebMarAprMayJunJulAugSepOctNovDecJanuaryFebruaryMarchAprilJuneJulyAugustSeptemberOctoberNovemberDecemberAMPM%a %b %e %H:%M:%S %Y__stack_smash_handlerstack overflow in function %sconnectlog_r__vsyslog_r/dev/log_rsyslog%s: unknown facility/priority: %x<%d>[%ld]Error %dlibcUnknown signal: Unknown error: _catopenNLSPATH/usr/share/nls/%L/%N.cat:/usr/share/nls/%l.%c/%N.cat:/usr/share/nls/%l/%N.catLC_ALLLC_MESSAGESLANG0D\t@]0Tdt$<Lp$8Xp $DTl Dh|$8Pt8Pd$@Undefined error: 0Operation not permittedNo such file or directoryNo such processInterrupted system callInput/output errorDevice not configuredArgument list too longExec format errorBad file descriptorNo child processesResource deadlock avoidedPermission deniedBad addressBlock device requiredDevice busyFile existsCross-device linkOperation not supported by deviceNot a directoryIs a directoryInvalid argumentToo many open files in systemToo many open filesInappropriate ioctl for deviceText file busyFile too largeNo space left on deviceIllegal seekRead-only file systemToo many linksNumerical argument out of domainResult too largeResource temporarily unavailableOperation now in progressOperation already in progressSocket operation on non-socketDestination address requiredMessage too longProtocol wrong type for socketProtocol not availableProtocol not supportedSocket type not supportedOperation not supportedProtocol family not supportedAddress family not supported by protocol familyAddress already in useCan't assign requested addressNetwork is downNetwork is unreachableNetwork dropped connection on resetSoftware caused connection abortConnection reset by peerNo buffer space availableSocket is already connectedSocket is not connectedCan't send after socket shutdownToo many references: can't spliceOperation timed outConnection refusedToo many levels of symbolic linksFile name too longHost is downNo route to hostDirectory not emptyToo many processesToo many usersDisk quota exceededStale NFS file handleToo many levels of remote in pathRPC struct is badRPC version wrongRPC prog. not availProgram version wrongBad procedure for programNo locks availableFunction not implementedInappropriate file type or formatAuthentication errorNeed authenticatorIPsec processing failureAttribute not foundIllegal byte sequenceNo medium foundWrong medium typeValue too large to be stored in data typeOperation canceledIdentifier removedNo message of desired typeNot supportedplt$0<Tht,@Tlvsnprintf !#&(*-/14LABCDEF7yACnF?O8M20HwZ?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ inet_pton01234567890123456789ABCDEF0123456789abcdefT""too small ((((( AAAAAABBBBBB   !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~%$sniglet^&isatty__put_page%s/_hash.XXXXXXHASH: Out of overflow pages. Increase page size tzloadmnGMT/etc/localtime/usr/share/zoneinfoposixrules,M4.1.0,M10.5.0abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ0123456789 :+-._Local time zone must be set--see zic manual pageasctime3JanFebMarAprMayJunJulAugSepOctNovDecSunMonTueWedThuFriSat??? ??? ?? ??:??:?? ???? %.3s %.3s%3d %2.2d:%2.2d:%2.2d %-4s %.3s %.3s%3d %2.2d:%2.2d:%2.2d %s _conv_fmt $(,048<@DHLT`h,pxĺZ-0%2d%03d%e-%b-%Y%04d%a %b %e %T %Ywrterrormalloc_initmalloc() warning: unknown char in MALLOC_OPTIONS recursive callregions_total not 2^xinternal struct corruptmunmap/etc/malloc.confMALLOC_OPTIONSmalloc init mmap failedmunmap roundmalloc cache underflowmalloc free slot lostmalloc cache overflowbogus pointer (double free?)bogus pointerguard sizemprotectchunk info corruptedmodified chunk-pointerchunk is already free in free():free() called before allocationmap roundmalloc cachepp & bits in posix_memalign():mapalign bad alignmentmapalign round in calloc(): in realloc(): in malloc():chacha_encrypt_bytes_rs_stirexpand 32-byte kexpand 16-byte ksnprintf|Tt4TpTTTTTTTTTTH9TLYT_UU1LULU8U0$U,U4UBUCUdU`xU`xU`xU,V,V,VPԣ Vt $V  (VL ,VL 4V 0Z > C @B>@|4?@ԆB@ȇ@ЇdBԇA܇?lADA@/tmp/EdDk.aXXXXXXXXXXذ $(,4<DP\dl|ذ2n$4 U(jjhX|P(ľHLTX|d8.? ɚ;0  ...$<i@?D?H?L?P?/P/p/`//t222P@z.BdBdBd(Bd4BdDB.dA"" e j    ky ( JKYdu f    bv z!w" (F2R r u'g <<p%[)]*())* * ){{}}{}(())()[[]][]#$G>> P30123456789.=:f/?/*?*n+n,N-N.&7m'E :e  :n:pt5T6:x&:d4-/:ttso_|%v !+ Hh VqQ:q:QZZ    l h b  w  i x X      0  $  k  j  is not a regular file (use -f to see it) is a directory~~aЄ܅fffbЄ@>g gBЄ@ghgcЄgggdЄAȅgheЄth8hLhfЄlhhFЄ|hhgЄhiiiijЄAj jJЄ!0jPjKЄЅhjjLЄjjmЄjjknЄ"k,k@kpЄH@PЄ?`kqЄllkkkrЄ"̅kklsЄ!\ltlSЄ!ąlluЄ"lllVЄL>wЄ"m8mlmxЄ(<mmXЄA؅mmyЄnnzЄԅ@nXn"Є;xn~Є!nn?Є;#Єh@nnЄAnnЄo4oЄXo|oo... (interrupt to abort) (press RETURN)[[D\444 Ȏмظ11"t €u6Uu|agPtPS[X!Using drive X, partition YMBR on floppy or old BIOS Read error No O/S No active partition OxUbđ0<ؑ40ؽ8xdH j,̒(<ļt88\(d< @Dw( @4ܜbAB\C`gD$E4FDGTHUd7Vadb@cpefxhiLlnĝq̝qԝrsvwxurrTXdl9txi d    D?T@d[x\\]^^̷_ط_`{{|$}0}D~LGMTܻ,8Ddp  Լ  ` ,8\hpdppppq@8hq:qq..0/.?Ȃlذ $(,4<DP\dl|ذ2n$4HPP @fkh455RuneCT10NONEBBBBB@@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@ @ @ @ @ @ @ @ @ @ @(@(@(@(@(@(@(@ @ @ @ @@@@@@@@@@@@@@@@@@@@@@@(@(@(@(@(@(@ @ @ @ @@@@@@@@@@@@@@@@@@@@@@@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@(@  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~Tpppppq8q :@qqdxz${X||,{|~t}d}l \Lp|pU VxUU- pU VxUU. dpU VxUU/̼̼|t0H$xTt$$X\$XXL(F P$T$S.shstrtab.init.text.fini.rodata.openbsd.randomdata.data.eh_frame.jcr.gotpad0.got.ctors.dtors.gotpad1.bss.stack.arm.atpcs.note.openbsd.ident ppS$T$%ii9iiS?IN=W=(\=Ƚc=нj=spxTT . ..chowndhclientm disklabeldmesgfdiskfsckn fsck_ext2fsfsck_ffsmifconfigminitnmknodmount mount_cd9660K mount_ext2fsK mount_ffs mount_msdos mount_nfsnewfs newfs_msdos newfs_ext2fsKpingnping6reboothaltnroutertsolumountsysctlbioctln6 ugen7 ulpt0 ulpt1 uhid0 uhid1 uhid2 uhid3 urio0 usb0 R usb1 usb2 usb3 usb4 usb5 usb6 usb7 ;; ttyU[0-9a-zA-Z]) U=${i#ttyU*} o=$(alph2d $U) M ttyU$U c 68 $o 660 dialer uucp M cuaU$U c 68 $(($o+128)) 660 dialer uucp ;; wsmux|wsmouse|wskbd) M wsmouse c 63 0 600 M wskbd c 63 1 600 ;; wsmouse[0-9]*) M wsmouse$U c 62 $U 600 ;; wskbd[0-9]*) M wskbd$U c 61 $U 600 ;; wscons) R wsmouse0 wsmouse1 wsmouse2 wsmouse3 wskbd0 wskbd1 wskbd2 R wskbd3 wsmux ttyCcfg ttyC0 ttyC1 ttyC2 ttyC3 ttyC4 ttyC5 R ttyC6 ttyC7 ttyC8 ttyC9 ttyCa ttyCb ;; tty[C-J]*) U=${i##tty[C-J]} case $i in ttyC*) n=C m=0;; ttyD*) n=D m=256;; ttyE*) n=E m=512;; ttyF*) n=F m=768;; ttyG*) n=G m=1024;; ttyH*) n=H m=1280;; ttyI*) n=I m=1536;; ttyJ*) n=J m=1792;; esac case $U in [0-9a-f]) M tty$n$U c 60 $((16#$U+$m)) 600;; cfg) M tty${n}cfg c 60 $((255+$m)) 600;; *) echo bad unit $U for $i; exit 1;; esac ;; pty*) if [ $U -gt 15 ]; then echo bad unit for pty in: $i continue fi set -A letters p q r s t u v w x y z P Q R S T set -A suffixes 0 1 2 3 4 5 6 7 8 9 a b c d e f g h i j k l m n o p q \ r s t u v w x y z A B C D E F G H I J K L M N O P Q R S T U V W X \ Y Z name=${letters[$U]} n=0 while [ $n -lt 62 ] do nam=$name${suffixes[$n]} off=$(($U*62)) M tty$nam c 4 $(($off+$n)) M pty$nam c 5 $(($off+$n)) n=$(($n+1)) done ;; ptm) M ptm c 98 0 666 ;; tty[0-7][0-9a-f]) U=${i#tty*} o=$(h2d $U) M tty$U c 12 $o 660 dialer uucp M cua$U c 12 $(($o+128)) 660 dialer uucp ;; st*) n=$(($U*16)) for pre in " " n e en do M ${pre}st$U b 25 $n 660 operator M ${pre}rst$U c 25 $n 660 operator n=$(($n+1)) done ;; vnd*) dodisk vnd $U 19 19 $U 0 ;; rd*) dodisk2 rd $U 18 18 $U 0 ;; ch*) M ch$U c 27 $U 660 operator ;; cd*) dodisk2 cd $U 26 26 $U 0 ;; local) test -s $T.local && sh $T.local ;; all) R gpio0 gpio1 gpio2 gpio3 gpio4 gpio5 gpio6 gpio7 gpio8 R bthub0 bthub1 bthub2 vnd0 vnd1 vnd2 vnd3 sd0 sd1 sd2 sd3 sd4 R sd5 sd6 sd7 sd8 sd9 cd0 cd1 rd0 tun0 tun1 tun2 tun3 bio bpf0 R bpf1 bpf2 bpf3 bpf4 bpf5 bpf6 bpf7 bpf8 bpf9 pty0 diskmap R vscsi0 ch0 fuse pppx hotplug ptm local wscons pci0 pci1 pci2 R pci3 uall rmidi0 rmidi1 rmidi2 rmidi3 rmidi4 rmidi5 rmidi6 R rmidi7 tuner0 radio0 video0 video1 uk0 random lkm tty00 R tty01 tty02 tty03 tty04 tty05 tty06 tty07 tty08 tty09 tty0a R tty0b apm crypto pf systrace wd0 wd1 wd2 wd3 std st0 st1 fd ;; wd*|sd*) case $i in wd*) dodisk wd $U 16 16 $U 0;; sd*) dodisk sd $U 24 24 $U 0;; esac ;; *) echo $i: unknown device ;; esac done } R "$@" { echo -n ${RMlist[*]} echo -n ${mklist[*]} echo -n ${MKlist[*]} echo -n ${whlist[*]} echo ${oplist[*]} } | if [ "$eo" = "echo" ]; then cat else sh fi #!/bin/sh - PATH=/sbin:/usr/sbin:/bin:/usr/bin T=$0 [ "$eo" ] || eo= hex() { case $1 in [0-9]) echo -n $1;; 10) echo -n a;; 11) echo -n b;; 12) echo -n c;; 13) echo -n d;; 14) echo -n e;; 15) echo -n f;; esac } alph2d() { local t="$1" local p="0123456789abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ" local sub=${p%${t}*} echo ${#sub} } h2d() { local s="$1" local f=${s%*[0-9a-f]} n=${s#[0-9a-f]*} echo $(($(_h2d $f)*16+ $(_h2d $n) )) } _h2d() { case $1 in [0-9]) echo -n $1;; a) echo -n 10;; b) echo -n 11;; c) echo -n 12;; d) echo -n 13;; e) echo -n 14;; f) echo -n 15;; esac } unt() { arg="$1" tmp="${arg#[a-zA-Z]*}" tmp="${tmp%*[a-zA-Z]}" while [ "$tmp" != "$arg" ] do arg=$tmp tmp="${arg#[a-zA-Z]*}" tmp="${tmp%*[a-zA-Z]}" done echo $arg } dodisk() { [ "$DEBUG" ] && set -x n=$(($((${5}*${7:-16}))+${6})) count=0 [ 0$7 -ne 8 ] && l="i j k l m n o p" for d in a b c d e f g h $l do M $1$2$d b $3 $(($n+$count)) 640 operator M r$1$2$d c $4 $(($n+$count)) 640 operator let count=count+1 done } dodisk2() { n=$(($(($5*${7:-16}))+$6)) M $1$2a b $3 $n 640 operator M r$1$2a c $4 $n 640 operator n=$(($n+2)) M $1$2c b $3 $n 640 operator M r$1$2c c $4 $n 640 operator } RMlist[0]="rm -f" mkl() { mklist[${#mklist[*]}]=";mknod -m $1 $2 $3 $4 $5" } M() { RMlist[${#RMlist[*]}]=$1 mkl ${5-666} $1 $2 $3 $4 G=${6:-wheel} [ "$7" ] && { MKlist[${#MKlist[*]}]="&& chown $7:$G $1" } || { case $G in wheel) [ ${#whlist[*]} = 0 ] && whlist[0]="&& chgrp wheel" whlist[${#whlist[*]}]="$1" ;; operator) [ ${#oplist[*]} = 0 ] && oplist[0]="&& chgrp operator" oplist[${#oplist[*]}]="$1" ;; *) MKlist[${#MKlist[*]}]="&& chgrp $G $1"; esac } return 0 } R() { [ "$DEBUG" ] && set -x for i in "$@" do U=`unt $i` [ "$U" ] || U=0 case $i in ramdisk) R std bpf0 wd0 wd1 sd0 tty00 rd0 wsmouse R st0 ttyC0 wskbd0 apm bio diskmap random ;; std) M console c 0 0 600 M tty c 1 0 M mem c 2 0 640 kmem M kmem c 2 1 640 kmem M null c 2 2 M zero c 2 12 M stdin c 7 0 M stdout c 7 1 M stderr c 7 2 M ksyms c 8 0 640 kmem M klog c 6 0 600 ;; vscsi*) M vscsi$U c 100 $U 600 ;; video*) M video$U c 38 $U MKlist[${#MKlist[*]}]=";[ -e video ] || ln -s video$U video" ;; tuner*) M tuner$U c 75 $(($(($U*2))+16)) 644 ;; systrace) M systrace c 50 0 644 ;; uk*) M uk$U c 28 $U 640 operator ;; tun*) M tun$U c 33 $U 600 ;; rmidi*) M rmidi$U c 57 $U 666 ;; *random) n=0 for pre in " " s u a do M ${pre}random c 40 $n 644 n=$(($n+1)) done ;; radio*) M radio$U c 97 $U MKlist[${#MKlist[*]}]=";[ -e radio ] || ln -s radio$U radio" ;; pppx*) M pppx$U c 103 $U 600 ;; pf*) M pf c 46 0 600 ;; pci*) M pci$U c 88 $U 600 MKlist[${#MKlist[*]}]=";[ -h pci ] || ln -sf pci0 pci" ;; lkm) M lkm c 35 0 640 _lkm ;; hotplug) M hotplug c 37 $U 400 ;; gpio*) M gpio$U c 13 $U 600 ;; fuse) M fuse$U c 77 $U 600 ;; fd) RMlist[${#RMlist[*]}]=";mkdir -p fd;rm -f" n=0 while [ $n -lt 64 ];do M fd/$n c 7 $n;n=$(($n+1));done MKlist[${#MKlist[*]}]=";chmod 555 fd" ;; diskmap) M diskmap c 102 0 640 operator ;; crypto) M crypto c 47 0 ;; bthub*) M bthub$U c 101 $U ;; bpf*) M bpf$U c 22 $U 600 ;; bktr*) M bktr$U c 75 $U 644 ;; bio) M bio c 52 0 600 ;; audio*) M sound$U c 36 $U M mixer$U c 36 $(($U+16)) M audio$U c 36 $(($U+128)) M audioctl$U c 36 $(($U+192)) MKlist[${#MKlist[*]}]=";[ -e audio ] || ln -s audio$U audio" MKlist[${#MKlist[*]}]=";[ -e mixer ] || ln -s mixer$U mixer" MKlist[${#MKlist[*]}]=";[ -e sound ] || ln -s sound$U sound" MKlist[${#MKlist[*]}]=";[ -e audioctl ] || ln -s audioctl$U audioctl" ;; apm*) M apm c 34 0 644 M apmctl c 34 8 644 ;; usb*) [ "$i" = "usb" ] && u= || u=$U M usb$u c 64 $U 660 ;; urio*) M urio$U c 67 $U 660 ;; ulpt*) M ulpt$U c 66 $U 660 ;; uhid*) M uhid$U c 65 $U 660 ;; ugen*) n=$(($U*16)) for j in 0{0,1,2,3,4,5,6,7,8,9} 1{0,1,2,3,4,5} do M ugen$U.$j c 70 $(($n+10#$j)) 660 done ;; uall) R ttyU0 ttyU1 ttyU2 ttyU3 ugen0 ugen1 ugen2 ugen3 ugen4 ugen5 R uge . ..MAKEDEVconsole  tty  mem kmem`o null`o zero`ostdinostdoutstderrksymsoklog`obpf0`owd0a`orwd0aowd0b`orwd0bowd0caorwd0cowd0daorwd0dowd0eaorwd0eowd0faorwd0fo wd0gao!rwd0go"wd0hao#rwd0ho$wd0iao%rwd0io&wd0jao'rwd0jo(wd0kbo)rwd0ko*wd0lbo+rwd0lo,wd0mbo-rwd0mo.wd0nbo/rwd0no0wd0obo1rwd0oo2wd0pbo3rwd0po4wd1abo5rwd1ao6wd1bbo7rwd1bo8wd1cco9rwd1co:wd1dco;rwd1do<wd1eco=rwd1eo>wd1fco?rwd1fo@wd1gcoArwd1goBwd1hcoCrwd1hoDwd1icoErwd1ioFwd1jcoGrwd1joHwd1kdoIrwd1koJwd1ldoKrwd1loLwd1mdoMrwd1moNwd1ndoOrwd1noPwd1odoQrwd1ooRwd1pdoSrwd1poTsd0adoUrsd0aoVsd0bdoWrsd0boXsd0ceoYrsd0coZsd0deo[rsd0do\sd0eeo]rsd0eo^sd0feo_rsd0fo`sd0geoarsd0gobsd0heocrsd0hodsd0ieoersd0iofsd0jeogrsd0johsd0kfoirsd0kojsd0lfokrsd0lolsd0mfomrsd0monsd0nfoorsd0nopsd0ofoqrsd0oorsd0pfosrsd0pottty00oucua00ovrd0afowrrd0aoxrd0cgoyrrd0cozwsmouse{wskbdo| st0}rst0go~nst0gonrst0oπest0goρerst0oςenst0oσenrst0τttyC0oυwskbd0 apmapmctlЈ biodiskmaprandomЋsrandomurandomarandomition on the disk. $(fdisk ${_disk}) __EOT fdisk -e ${_disk} [[ -n $(fdisk $_disk | grep ' A6 ') ]] && return echo No OpenBSD partition in MBR, try again. ;; o*|O*) return ;; esac done } md_prep_disklabel() { local _disk=$1 _f _op md_prep_fdisk $_disk _f=/tmp/fstab.$_disk if [[ $_disk == $ROOTDISK ]]; then while :; do echo "The auto-allocated layout for $_disk is:" disklabel -h -A $_disk | egrep "^# |^ [a-p]:" ask "Use (A)uto layout, (E)dit auto layout, or create (C)ustom layout?" a case $resp in a*|A*) _op=-w ;; e*|E*) _op=-E ;; c*|C*) break ;; *) continue ;; esac disklabel $FSTABFLAG $_f $_op -A $_disk return done fi cat <<__EOT You will now create an OpenBSD disklabel inside the OpenBSD MBR partition. The disklabel defines how OpenBSD splits up the MBR partition into OpenBSD partitions in which filesystems and swap space are created. You must provide each filesystem's mountpoint in this program. The offsets used in the disklabel are ABSOLUTE, i.e. relative to the start of the disk, NOT the start of the OpenBSD MBR partition. __EOT disklabel $FSTABFLAG $_f -E $_disk } md_congrats() { } md_consoleinfo() { } dmesg | grep "^omap0 at mainbus0:" >/dev/null if [[ $? == 0 ]]; then MDPLAT=OMAP LOADADDR=0x82800000 fi dmesg | grep "^imx0 at mainbus0:" >/dev/null if [[ $? == 0 ]]; then MDPLAT=IMX LOADADDR=0x18800000 fi dmesg | grep "^sunxi0 at mainbus0:" >/dev/null if [[ $? == 0 ]]; then MDPLAT=SUNXI LOADADDR=0x40200000 fi MDSETS="bsd.${MDPLAT} bsd.rd.${MDPLAT} bsd.${MDPLAT}.umg bsd.rd.${MDPLAT}.umg" SANESETS="bsd.${MDPLAT}" DEFAULTSETS=${MDSETS} NEWFSARGS_msdos="-F 16 -L boot" NEWFSARGS_ext2fs="-v boot" md_installboot() { local _disk=$1 mount /dev/${_disk}i /mnt/mnt BEAGLE=$(scan_dmesg '/^omap0 at mainbus0: \(BeagleBoard\).*/s//\1/p') BEAGLEBONE=$(scan_dmesg '/^omap0 at mainbus0: \(BeagleBone\).*/s//\1/p') PANDA=$(scan_dmesg '/^omap0 at mainbus0: \(PandaBoard\)/s//\1/p') IMX=$(scan_dmesg '/^imx0 at mainbus0: \(i.MX6.*\)/s//IMX/p') SUNXI=$(scan_dmesg '/^sunxi0 at mainbus0: \(A.*\)/s//SUNXI/p') if [[ -f /mnt/bsd.${MDPLAT} ]]; then mv /mnt/bsd.${MDPLAT} /mnt/bsd fi if [[ -f /mnt/bsd.${MDPLAT}.umg ]]; then mv /mnt/bsd.${MDPLAT}.umg /mnt/mnt/bsd.umg fi if [[ -f /mnt/bsd.mp.${MDPLAT} ]]; then mv /mnt/bsd.mp.${MDPLAT} /mnt/bsd.mp fi if [[ -f /mnt/bsd.rd.${MDPLAT} ]]; then mv /mnt/bsd.rd.${MDPLAT} /mnt/bsd.rd fi if [[ -f /mnt/bsd.rd.${MDPLAT}.umg ]]; then mv /mnt/bsd.rd.${MDPLAT}.umg /mnt/mnt/bsdrd.umg fi tar -C /mnt/ -xf /usr/mdec/u-boots.tgz if [[ ${MDPLAT} == "OMAP" ]]; then if [[ -n $BEAGLE ]]; then cp /mnt/usr/mdec/beagle/{mlo,u-boot.bin} /mnt/mnt/ elif [[ -n $BEAGLEBONE ]]; then cp /mnt/usr/mdec/am335x/{mlo,u-boot.img} /mnt/mnt/ elif [[ -n $PANDA ]]; then cp /mnt/usr/mdec/panda/{mlo,u-boot.bin} /mnt/mnt/ fi cat > /mnt/mnt/uenv.txt<<__EOT bootcmd=mmc rescan ; setenv loadaddr ${LOADADDR}; setenv bootargs sd0i:/bsd.umg ; fatload mmc \${mmcdev} \${loadaddr} bsd.umg ; bootm \${loadaddr} ; uenvcmd=boot __EOT elif [[ ${MDPLAT} == "IMX" ]]; then cat > /tmp/6x_bootscript.scr<<__EOT ; setenv loadaddr ${LOADADDR} ; setenv bootargs sd0i:/bsd.umg ; for dtype in sata mmc ; do for disk in 0 1 ; do \${dtype} dev \${disk} ; for fs in fat ext2 ; do if \${fs}load \${dtype} \${disk}:1 \${loadaddr} bsd.umg ; then bootm \${loadaddr} ; fi ; done; done; done; echo; echo failed to load bsd.umg __EOT mkuboot -t script -a arm -o linux /tmp/6x_bootscript.scr /mnt/mnt/6x_bootscript elif [[ ${MDPLAT} == "SUNXI" ]]; then cat > /mnt/mnt/uenv.txt<<__EOT bootargs=sd0i:/bsd mmcboot=mmc rescan ; fatload mmc 0 ${LOADADDR} bsd.umg && bootm ${LOADADDR}; uenvcmd=run mmcboot; __EOT cp /mnt/usr/mdec/sunxi/{sunxi-spl,u-boot}.bin /mnt/mnt/ fi } md_prep_fdisk() { local _disk=$1 _q _d local bootparttype="C" local bootfstype="msdos" local newfs_args=${NEWFSARGS_msdos} IMX=$(scan_dmesg '/^imx0 at mainbus0: \(i.MX6.*\)/s//IMX/p') if [[ -n $IMX ]]; then bootparttype="83" bootfstype="ext2fs" newfs_args=${NEWFSARGS_ext2fs} fi while :; do _d=whole if [[ -n $(fdisk $_disk | grep 'Signature: 0xAA55') ]]; then fdisk $_disk else echo "MBR has invalid signature; not showing it." fi ask "Use (W)hole disk$_q or (E)dit the MBR?" "$_d" case $resp in w*|W*) echo -n "Creating a ${bootfstype} partition and an OpenBSD partition for rest of $_disk..." fdisk -e ${_disk} <<__EOT >/dev/null reinit e 0 ${bootparttype} n 64 32768 f 0 e 3 A6 n 32832 write quit __EOT echo "done." disklabel $_disk 2>/dev/null | grep -q "^ i:" || disklabel -w -d $_disk newfs -t ${bootfstype} ${newfs_args} ${_disk}i return ;; e*|E*) cat <<__EOT You will now create one MBR partition to contain your OpenBSD data and one MBR partition on which kernels are located which are loaded by U-Boot. Neither partition will overlap any other partition. The OpenBSD MBR partition will have an id of 'A6' and the boot MBR partition will have an id of '${bootparttype}' (${bootfstype}). The boot partition will be at least 16MB and be the first 'MSDOS' part#!/bin/ksh MODE=install . install.sub DISK= DISKS_DONE= _DKDEVS=$(get_dkdevs) _fsent= rm -f /tmp/fstab* ask_yn "Use DUIDs rather than device names in fstab?" yes [[ $resp == y ]] && FSTABFLAG=-F while :; do DISKS_DONE=$(addel "$DISK" $DISKS_DONE) _DKDEVS=$(rmel "$DISK" $_DKDEVS) if isin $ROOTDISK $_DKDEVS; then resp=$ROOTDISK rm -f /tmp/fstab else ask_which "disk" "do you wish to initialize" \ '$(l=$(get_dkdevs); for a in $DISKS_DONE; do l=$(rmel $a $l); done; bsort $l)' \ done [[ $resp == done ]] && break fi DISK=$resp makedev $DISK || continue rm -f /tmp/*.$DISK md_prep_disklabel $DISK || { DISK= ; continue ; } grep -qs " / ffs " /tmp/fstab.$ROOTDISK || { DISK= ; echo "'/' must be configured!" ; continue ; } if [[ -f /tmp/fstab.$DISK ]]; then while read _pp _mp _rest; do if [[ $_mp == none ]]; then echo "$_pp $_mp $_rest" >>/tmp/fstab continue fi [[ /tmp/fstab.$DISK == $(grep -l " $_mp " /tmp/fstab.*) ]] || { _rest=$DISK ; DISK= ; break ; } done /etc/fstab rm /tmp/fstab.$_rest set -- $(grep -h " $_mp " /tmp/fstab.*[0-9]) echo "$_pp and $1 can't both be mounted at $_mp." continue fi while read _pp _mp _fstype _rest; do [[ $_fstype == ffs ]] || continue _OPT= [[ $_mp == / ]] && _OPT=$MDROOTFSOPT newfs -q $_OPT ${_pp##/dev/} _fsent="$_fsent $_mp!$_pp" done >/tmp/fstab munge_fstab mount_fs "-o async" feed_random install_sets if [[ -z $TZ ]]; then (cd /mnt/usr/share/zoneinfo ls -1dF $(tar cvf /dev/null [A-Za-y]*) >/mnt/tmp/tzlist ) echo set_timezone /mnt/tmp/tzlist rm -f /mnt/tmp/tzlist fi if _time=$(ftp_time) && _now=$(date +%s) && (( _now - _time > 120 || _time - _now > 120 )); then _tz=/mnt/usr/share/zoneinfo/$TZ ask_yn "Time appears wrong. Set to '$(TZ=$_tz date -r "$(ftp_time)")'?" yes if [[ $resp == y ]]; then date $(date -r "$(ftp_time)" "+%Y%m%d%H%M.%S") >/dev/null fi fi if [[ -s $SERVERLISTALL ]]; then _i= [[ -n $installedfrom ]] && _i="install=$installedfrom" [[ -n $TZ ]] && _i="$_i&TZ=$TZ" [[ -n $method ]] && _i="$_i&method=$method" [[ -n $_i ]] && ftp -Vao - \ "http://129.128.5.191/cgi-bin/ftpinstall.cgi?$_i" >/dev/null 2>&1 & fi sed "/^console.*on.*secure.*$/s/std\.[0-9]*/std.$(stty speed /tmp/ttys mv /tmp/ttys /mnt/etc/ttys echo -n "Saving configuration files..." (cd /var/db; [[ -f dhclient.leases ]] && mv dhclient.leases /mnt/var/db/. ) hostname >/tmp/myname if [[ -f /tmp/hosts ]]; then _dn=$(get_fqdn) while read _addr _hn _aliases; do if [[ -n $_aliases || $_hn != ${_hn%%.*} || -z $_dn ]]; then echo "$_addr\t$_hn $_aliases" else echo "$_addr\t$_hn.$_dn $_hn" fi done >/mnt/etc/hosts rm /tmp/hosts fi _f=dhclient.conf [[ -f /tmp/$_f ]] && { cat /tmp/$_f >>/mnt/etc/$_f ; rm /tmp/$_f ; } (cd /tmp; for _f in fstab hostname* kbdtype my* ttys *.conf *.tail; do [[ -f $_f && -s $_f ]] && mv $_f /mnt/etc/. done) apply if [[ -n $user ]]; then _encr=$(encr_pwd "$userpass") _home=/home/$user uline="${user}:${_encr}:1000:1000:staff:0:0:${username}:$_home:/bin/ksh" echo "$uline" >> /mnt/etc/master.passwd echo "${user}:*:1000:" >> /mnt/etc/group echo ${user} > /mnt/root/.forward _home=/mnt$_home mkdir -p $_home (cd /mnt/etc/skel; cp -pR . $_home) (umask 077 && sed "s,^To: root\$,To: ${username} <${user}>," \ /mnt/var/mail/root > /mnt/var/mail/$user ) chown -R 1000:1000 $_home /mnt/var/mail/$user echo "1,s@wheel:.:0:root\$@wheel:\*:0:root,${user}@ w q" | ed /mnt/etc/group 2>/dev/null [[ -n "$userkey" ]] && print -r -- "$userkey" >> $_home/.ssh/authorized_keys fi if [[ -n "$_rootpass" ]]; then _encr=$(encr_pwd "$_rootpass") echo "1,s@^root::@root:${_encr}:@ w q" | ed /mnt/etc/master.passwd 2>/dev/null fi /mnt/usr/sbin/pwd_mkdb -p -d /mnt/etc /etc/master.passwd [[ -n "$rootkey" ]] && ( umask 077 mkdir /mnt/root/.ssh print -r -- "$rootkey" >> /mnt/root/.ssh/authorized_keys ) if grep -qs '^rtsol' /mnt/etc/hostname.*; then sed -e "/^#\(net\.inet6\.ip6\.accept_rtadv\)/s//\1/" \ -e "/^#\(net\.inet6\.icmp6\.rediraccept\)/s//\1/" \ /mnt/etc/sysctl.conf >/tmp/sysctl.conf cp /tmp/sysctl.conf /mnt/etc/sysctl.conf fi finish_up nt $_ifdev _lf=/var/db/dhclient.leases.$_ifdev _server=$(sed "/^ *next-server /!d;s///;s/;$//;q" $_lf) _mode=$(sed -E '/^ *filename "auto_(install|upgrade)";$/!d;s//\1/;q' \ $_lf) _mac=$(ifconfig $_ifdev | sed 's/.*lladdr \(.*\)/\1/p;d') hostname "$(sed -E '/^ *option host-name "(.*)";$/!d;s//\1/;q' $_lf)" if [[ -z $_server ]]; then echo "Could not determine next-server." elif [[ -z $_mode ]]; then echo "Could not determine auto mode." else for _f in {$_mac-,}$_mode; do ftp -o "/$_mode.conf" "http://$_server/$_f.conf" && action=$_mode && return 0 done fi return 1 } if ! $auto; then cat <<__EOT At any prompt except password prompts you can escape to a shell by typing '!'. Default answers are shown in []'s and are selected by pressing RETURN. You can exit this program at any time by pressing Control-C, but this can leave your system in an inconsistent state. __EOT elif [[ -z $respfile ]]; then if ! get_responsefile; then echo "No response file found; non-interactive mode aborted." exit 1 fi rm -f /ai.done echo "Performing non-interactive $action..." /$action -af /$action.conf 2>&1 >$_lf chmod 600 $_lf _lf=${_lf#/mnt} cat <<__EOT >>/mnt/etc/rc.firsttime ( /usr/bin/mail -s '$(hostname) $action log' root < $_lf && rm $_lf ) >/dev/null 2>&1 & __EOT exec reboot else echo "failed; check /ai.log" exit 1 fi else cp $respfile /ai.conf || exit fi set_term if [[ $MODE == install ]]; then ask_until "System hostname? (short form, e.g. 'foo')" "$(hostname -s)" [[ ${resp%%.*} != $(hostname -s) ]] && hostname $resp THESETS="$THESETS site$VERSION-$(hostname -s).tgz" echo donetconfig ((nifs != 0)) && startftplist echo while :; do askpassword "Password for root account?" _rootpass="$_password" [[ -n "$_password" ]] && break echo "The root password must be set." done rootkey= $auto && ask "Public ssh key for root account?" none && [[ $resp != none ]] && rootkey=$resp questions user_setup set_timezone /var/tzlist echo fi diskinfo() { local _d for _d; do makedev $_d echo -n "$_d: " disklabel -dpg $_d 2>/dev/null | sed -e '/^label: /{s,,,;s/ *$//;s/^$//;H;d;}' \ -e '/.*# total bytes: \(.*\)/{s//(\1)/;H;}' \ -e '$!d;x;s/\n/ /' rm -f /dev/{r,}$_d? done } while :; do echo "Available disks are: $(get_dkdevs | sed 's/^$/none/')." _ask "Which disk is the root disk? ('?' for details)" \ $(get_dkdevs | sed 's/ .*//') || continue case $resp in "?") diskinfo $(get_dkdevs);; '') ;; *) isin "$resp" $(get_dkdevs) && break echo "no such disk";; esac done makedev $resp || exit ROOTDISK=$resp ROOTDEV=${ROOTDISK}a SWAPDEV=${ROOTDISK}b usage() { echo "usage: ${0##*/} [-a] [-f filename]" >&2 exit 1 } auto=false respfile= while getopts "af:" opt; do case $opt in a) auto=true;; f) respfile=$OPTARG;; *) usage;; esac done shift $((OPTIND-1)) [ $# = 0 ] || usage . install.md set_term() { local _layouts export TERM=${TERM:-${MDTERM:-vt220}} if [[ -n $CONSOLE ]]; then ask "Terminal type?" $TERM export TERM=$resp else [[ -x /sbin/kbd ]] || return _layouts=$(bsort $(kbd -l | egrep -v "^(user|tables|encoding)")) while :; do ask "Choose your keyboard layout ('?' or 'L' for list)" "default" case $resp in "?"|L|l) echo "Available layouts: $_layouts";; default) return;; *) kbd $resp && { echo $resp >/tmp/kbdtype; return; };; esac done fi } stripcom () { local _l [[ -f $1 ]] || return set -o noglob while read _l; do [[ -n ${_l%%#*} ]] && echo $_l done <$1 set +o noglob } quote() ( for a; do alias Q=$a; a=$(alias Q); print -rn -- " ${a#Q=}" done | sed '1s/ //' echo ) tmpdir() { local _i=1 _dir until _dir="${1?}.$_i.$RANDOM" && mkdir -- "$_dir" 2>/dev/null; do ((++_i < 10000)) || return 1 done echo "$_dir" } scan_dmesg() { bsort $(sed -n "$1" /var/run/dmesg.boot) } scan_disknames() { local IFS=, bsort $(for _n in $(sysctl -n hw.disknames); do echo "${_n%%:*} "; done | sed -n "$1") } get_dkdevs () { echo $(scan_disknames "${MDDKDEVS:-/^[sw]d[0-9][0-9]* /s/ .*//p}") } get_cddevs () { echo $(scan_disknames "${MDCDDEVS:-/^cd[0-9][0-9]* /s/ .*//p}") } get_ifdevs() { ifconfig "$@" 2>/dev/null | egrep -v '^[[:space:]]|(bridge|enc|gif|gre|lo|pflog|pfsync|ppp|sl|tun)[[:digit:]]+:' | sed -n 's/^\(.*\):.*/\1/p' } get_drive() { ask_which "$1" "contains the $MODE media" "$2" "$3" [[ $resp == done ]] && return 1 makedev $resp || return 1 return 0 } mount_mnt2() { local _dev=$1 _opts _file=/tmp/parts.$1 _parts disklabel $_dev 2>/dev/null | sed -En '/swap|unused/d;/^ [a-p]: /p' >$_file _parts=$(sed 's/^ \(.\): .*/\1/' $_file) set -- $_parts (($# == 0)) && { echo "No filesystems found on $_dev."; return 1; } if isin "c" $_parts; then resp=c elif (($# == 1)); then resp=$1 else cat $_file ask_which "$_dev partition" "has the $MODE sets" \ '$(disklabel '$_dev' 2>/dev/null | sed -En '\''/swap|unused/d;/^ ([a-p]): .*/s//\1/p'\'')' [[ $resp == done ]] && return 1 fi grep -q "^ $resp: .*MSDOS" $_file && _opts="-s" mount -o ro,$_opts /dev/$_dev$resp /mnt2 } askpass() { stty -echo IFS= read -r resp?"$1 " stty echo echo } rm -df /tmp/lock lock() { while ! mkdir /tmp/lock 2>/dev/null && sleep .1; do done } unlock() { rm -d /tmp/lock 2>/dev/null } retrap() { trap 'kill -KILL $cppid 2>/dev/null; echo; stty echo; exit 0' \ INT EXIT TERM } rm -f /tmp/update if ! $auto; then ( while :; do lock if test -e /tmp/update && [[ "`dmesg`" != "`cat /tmp/update`" ]]; then dmesg >/tmp/update kill -TERM 2>/dev/null $$ || exit 1 fi unlock sleep .5 done ) |& cppid=$! retrap fi _ask() { local _q=$1 _def=$2 _int _redo=0 _pid lock; dmesg >/tmp/update; unlock echo -n "${_q:+$_q }${_def:+[$_def] }" _autorespond "$_q" "$_def" && echo "$resp" && return trap "_int=1" INT trap "_redo=1" TERM read resp lock; rm /tmp/update; unlock if ((_redo)); then stty raw stty -raw else case $resp in !) echo "Type 'exit' to return to install." sh _redo=1 ;; !*) eval "${resp#?}" _redo=1 ;; esac fi retrap ((_int)) && kill -INT $$ : ${resp:=$_def} return $_redo } _autorespond() { typeset -l _q=$1 _key local _def=$2 _l _val [[ -f $respfile ]] || return mv /ai.conf /ai.conf.tmp while IFS=' ' read -r _l; do [[ $_l == [!#=]*=?* ]] || continue _key=${_l%%*([[:blank:]])=*} _val=${_l##*([!=])=*([[:blank:]])} [[ $_q == @(|*[[:blank:]])"$_key"@([[:blank:]?]*|) ]] && resp=$_val && cat && return print -r " $_l" done /ai.conf [[ -n $_def ]] && resp=$_def && return echo "\nQuestion has no answer in response file." exit 1 } ask() { while ! _ask "$1" "$2"; do done } askpassword() { local _q=$1 if $auto; then echo -n "$_q " _autorespond "$_q" echo '' _password=$resp return fi while :; do askpass "$_q (will not echo)" _password=$resp askpass "$_q (again)" [[ $resp == "$_password" ]] && break echo "Passwords do not match, try again." done } encr_pwd() { local _p=$1 if [[ -z $_p ]]; then echo '*' elif [[ $_p == \$2?\$[0-9][0-9]\$* && ${#_p} > 40 || $_p == '*************' ]]; then echo "$_p" else /mnt/usr/bin/encrypt -b 8 -- "$_p" fi } user_setup() { local _q="Setup a user? (enter a lower-case loginname, or 'no')" while :; do ask "$_q" no case $resp in n|no) return;; y|yes) _q="No really, what is the lower-case loginname, or 'no'?" continue;; root|daemon|operator|bin|smmsp|popa3d) ;; sshd|uucp|www|named|proxy|nobody|ftp) ;; [a-z]*([a-z0-9_])) ((${#resp} <= 31)) && break;; esac echo "$resp is not a useable loginname." done user=$resp while :; do ask "Full name for user $user?" $user case $resp in *[:\&,]*) echo "':', '&' or ',' are not allowed.";; *) ((${#resp} <= 100)) && break echo "Too long.";; esac done username=$resp askpassword "Password for user $user?" userpass=$_password userkey= $auto && ask "Public ssh key for user $user" none && [[ $resp != none ]] && userkey=$resp if [[ $sshd == y ]]; then ask_yn "Since you set up a user, disable sshd(8) logins to root?" yes sshd_disableroot=$resp fi } function ask_until { resp= while true; do ask "$1" "$2" [[ -n $resp ]] && break echo "A response is required." $auto && exit 1 done } ask_yn() { local _q=$1 _a=${2:-no} typeset -l _resp while :; do ask "$_q" "$_a" _resp=$resp case $_resp in y|yes) resp=y; return 0;; n|no) resp=n; return 1;; esac echo "'$resp' is not a valid choice." $auto && exit 1 done } ask_which() { local _name=$1 _query=$2 _list=$3 _def=$4 _dynlist _dyndef _key _q _key=$(echo "$_name" | sed 's/[^[:alnum:]]/_/g') while :; do eval "_dynlist=\"$_list\"" eval "_dyndef=\"$_def\"" set -o noglob set -- $_dyndef; _dyndef="$1" set -- $_dynlist; _dynlist="$*" set +o noglob (($# < 1)) && resp=done && return : ${_dyndef:=$1} echo "Available ${_name}s are: $_dynlist." _q="Which $_name $_query?" echo -n "$_q (or 'done') ${_dyndef:+[$_dyndef] }" _autorespond "$_q" "${_dyndef-done}" && echo "$resp" \ || _ask || continue [[ -z $resp ]] && resp="$_dyndef" isin "$resp" $_dynlist done && break echo "'$resp' is not a valid choice." $auto && [[ -n $respfile ]] && exit 1 done } isin() { local _a=$1 _b shift for _b; do [[ $_a == $_b ]] && return 0 done return 1 } addel() { local _a=$1 shift echo -n "$*" isin "$_a" $* || echo -n " $_a" } rmel() { local _a=$1 _b shift for _b; do [[ $_a != $_b ]] && echo -n "$_b " done } bsort() { local _l _a=$1 _b (($# > 0)) || return shift for _b; do if [[ $_a != $_b ]]; then if [[ $_a > $_b ]]; then _l="$_a $_l"; _a=$_b else _l="$_b $_l" fi fi done echo -n "$_a " bsort $_l } showcols() { local _l _cdir=/tmp/cdir set -A _clist mkdir -p $_cdir rm -rf -- $_cdir/* while read _l; do [ "$_l" ] || continue mkdir -p /tmp/cdir/"$_l" _clist[${#_clist[*]}]="$_l" done (cd $_cdir; ls -Cdf "${_clist[@]}") rm -rf -- $_cdir } makedev() { [[ -z $(cd /dev && sh MAKEDEV "$@" 2>&1) ]] } addhostent() { local _addr=$1 _name=$2 _delim="." [[ -z $_addr || -z $_name ]] && return [[ $_addr == *:* ]] && _delim=":" sed "/^[0-9a-fA-F]*[$_delim].*[ ]$_name\$/d" /tmp/hosts \ >/tmp/hosts.new 2>/dev/null mv /tmp/hosts.new /tmp/hosts echo "$_addr $_name" >>/tmp/hosts } select_sets() { local _avail=$1 _selected=$2 _f _action _col=$COLUMNS local _comp=comp${VERSION}.tgz _xbase=xbase${VERSION}.tgz let COLUMNS=_col-8 cat <<__EOT Select sets by entering a set name, a file name pattern or 'all'. De-select sets by prepending a '-' to the set name, file name pattern or 'all'. Selected sets are labelled '[X]'. __EOT while :; do for _f in $_avail; do isin $_f $_selected && echo "[X] $_f" || echo "[ ] $_f" done | showcols | sed 's/^/ /' ask "Set name(s)? (or 'abort' or 'done')" done set -o noglob for resp in $resp; do case $resp in abort) _selected=; break 2;; done) break 2;; -*) _action=rmel;; *) _action=addel;; esac resp=${resp#[+-]} [[ $resp = all ]] && resp=* for _f in $_avail; do [[ $_f = $resp ]] && _selected=$($_action $_f $_selected) done done if isin $_xbase $_selected && ! isin $_comp $_selected && isin $_comp $_avail; then _selected=$(addel $_comp $_selected) echo "The xbase set requires the comp set, so adding it back in." fi done set +o noglob COLUMNS=$_col resp=$_selected } configure_ifs() { local _first _ifdevs _ifs _name _hn _vl=0 _vd _vi _p _tags while :; do _vd=$(ifconfig vlan$_vl 2>&1) [[ $_vd == @(*no such interface*) ]] && break [[ $_vd == @(vlan$_vl: flags=0<>*) ]] && break ((_vl++)) done _vd= ifconfig lo0 inet 127.0.0.1/8 while :; do ifconfig vlan$_vl create >/dev/null 2>&1 ask_which "network interface" "do you wish to configure" \ '$(get_ifdevs)' \ ${_p:-'$( (get_ifdevs netboot; get_ifdevs) | sed q )'} [[ $resp == done ]] && break _ifs=$resp _hn=/tmp/hostname.$_ifs rm -f $_hn if [[ $_ifs == vlan[0-9]* ]]; then _vi=$(ifconfig $_ifs 2>/dev/null | sed -n 's/vlan: \([0-9]*\).*/\1/p') _tags=$(ifconfig vlan 2>/dev/null | sed -n 's/vlan: \([0-9]*\).*/\1/p') [[ -n $_tags ]] && _tags=$(rmel "$_vi" $_tags) if [[ -z $_vi ]]; then _vi=0 while ((++_vi < 4096)); do ! isin "$_vi" $_tags && break done fi _ifdevs=$(get_ifdevs) set -- $_ifdevs while [[ $1 == vlan[0-9]* ]]; do shift done ask "Which interface:tag should $_ifs be on?" "${_vd:=$1}:$_vi" _vd=${resp%%:*} _vi=${resp##*:} if ! (isin "$_vd" $_ifdevs && [[ $_vd != vlan[0-9]* ]]); then echo "Invalid interface choice '$_vd'" _vd= continue fi if ((_vi < 1 || _vi > 4095)) || isin "$_vi" $_tags; then echo "Invalid or in-use vlan tag '$_vi'" continue fi grep -qs "^up" /tmp/hostname.$_vd || echo "up" >>/tmp/hostname.$_vd chmod 640 /tmp/hostname.$_vd ifconfig $_vd up ifconfig $_ifs destroy >/dev/null 2>&1 ifconfig $_ifs vlan $_vi vlandev $_vd echo "vlan $_vi vlandev $_vd" >>$_hn [[ ${_ifs##vlan} == $_vl ]] && ((_vl++)) fi ifconfig $_ifs 2>/dev/null | grep -q "^[[:space:]]*ieee80211:" && ieee80211_config $_ifs $_hn resp=$(hostname -s) [[ -n $_first && $_first != $_ifs ]] && ask "Symbolic (host) name for $_ifs?" $resp _name=$resp v4_config $_ifs $_name $_hn v6_config $_ifs $_name $_hn if [[ -f $_hn ]]; then chmod 640 $_hn ((nifs++)) : ${_first:=$_ifs} _p=done fi done } v4_info() { ifconfig $1 inet | sed -n ' 1s/.*/dev/null /sbin/dhclient "$@" } dhcp_request() { local _ifs=$1 _hn=$2 echo "lookup file bind" >/etc/resolv.conf.tail if [[ -n $_hn ]]; then _hn="send host-name \"$_hn\";" echo "Issuing hostname-associated DHCP request for $_ifs." else echo "Issuing free-roaming DHCP request for $_ifs." fi cat >/etc/dhclient.conf <<__EOT initial-interval 1; $_hn request subnet-mask, broadcast-address, routers, domain-name, domain-name-servers, host-name; __EOT ifconfig $_ifs group dhcp >/dev/null 2>&1 dhclient $_ifs set -- $(v4_info $_ifs) if [[ $1 == UP && -n $2 ]]; then mv /etc/dhclient.conf /tmp/dhclient.conf mv /etc/resolv.conf.tail /tmp/resolv.conf.tail return 0 fi ifconfig $_ifs delete down -group dhcp 2>/dev/null rm /etc/dhclient.conf /etc/resolv.conf.tail return 1 } hextodec() { local _d _b for _b in $(echo ${1#0x} | sed 's/\(..\)/\1 /g'); do _d=$_d.$((0x$_b)) done echo ${_d#.} } ieee80211_scan() { [[ -f $WLANLIST ]] || ifconfig $1 scan | sed -n 's/^ nwid \([^"]\)/\1/p' >$WLANLIST cat $WLANLIST } ieee80211_config() { local _ifs=$1 _hn=$2 _prompt _nwid _haswpa=0 _err ifconfig $_ifs -nwid -nwkey ifconfig $_ifs -wpa 2>/dev/null && _haswpa=1 rm -f $WLANLIST while [[ -z $_nwid ]]; do ask_until "Access point? (ESSID, 'any', list# or '?')" "any" case "$resp" in +([0-9])) _nwid=$(ieee80211_scan $_ifs | sed -n "${resp}s/ .*//p") [[ -z $_nwid ]] && echo "There is no line $resp." ;; \?) ieee80211_scan $_ifs | sed -n 's/^\([^ ]*\) chan .* bssid \([^ ]*\) .*$/ \1 (\2)/p' | less -XEN ;; *) _nwid=$resp;; esac done if [[ $_nwid != any ]]; then ifconfig $_ifs nwid "$_nwid" quote nwid "$_nwid" >>$_hn _prompt="Security protocol? (O)pen, (W)EP" ((_haswpa == 1)) && _prompt="$_prompt, WPA-(P)SK" while :; do ask_until "$_prompt" "O" case "$_haswpa-$resp" in ?-[Oo]) break ;; ?-[Ww]) ask_until "WEP key? (will echo)" if _err=$(ifconfig $_ifs nwkey "$resp" 2>&1) && [[ -z $_err ]]; then quote nwkey "$resp" >>$_hn break fi echo "$_err" ;; 1-[Pp]) ask_until "WPA passphrase? (will echo)" if ifconfig $_ifs wpakey "$resp"; then quote wpakey "$resp" >>$_hn break fi ;; *) echo "'$resp' is not a valid choice." ;; esac done fi } v4_config() { local _ifs=$1 _name=$2 _hn=$3 _prompt _addr _mask if ifconfig $_ifs | grep -q 'groups:.* dhcp'; then _addr=dhcp else set -- $(v4_info $_ifs) if [[ -n $2 ]]; then _addr=$2; _mask=$(hextodec $3) ifconfig $_ifs inet $_addr delete fi fi if [[ -x /sbin/dhclient ]]; then _prompt="or 'dhcp' " ifconfig dhcp >/dev/null 2>&1 || _addr=dhcp fi _prompt="IPv4 address for $_ifs? (${_prompt}or 'none')" ask_until "$_prompt" "$_addr" case $resp in none) ;; dhcp) if [[ ! -x /sbin/dhclient ]]; then echo "DHCP not possible - no /sbin/dhclient." elif dhcp_request $_ifs "$_name" || dhcp_request $_ifs; then echo "dhcp" >>$_hn fi ;; *) _addr=$resp ask_until "Netmask?" "${_mask:=255.255.255.0}" ifconfig $_ifs -group dhcp >/dev/null 2>&1 if ifconfig $_ifs inet $_addr netmask $resp up; then addhostent "$_addr" "$_name" echo "inet $_addr $resp" >>$_hn fi ;; esac } v6_config() { local _ifs=$1 _name=$2 _hn=$3 _addr _prefixlen _prompt ifconfig lo0 inet6 >/dev/null 2>&1 || return set -- $(v6_info $_ifs) [[ -n $2 ]] && { _addr=$2; _prefixlen=$3; } [[ -x /sbin/rtsol ]] && _prompt="or 'rtsol' " _prompt="IPv6 address for $_ifs? (${_prompt}or 'none')" ask_until "$_prompt" "${_addr:-none}" case $resp in none) return ;; rtsol) [[ ! -x /sbin/rtsol ]] && { echo "No /sbin/rtsol."; return; } ifconfig $_ifs up if rtsol -F $_ifs; then echo "up\nrtsol" >>$_hn fi return ;; esac _addr=$resp ask_until "IPv6 prefix length for $_ifs?" "${_prefixlen:=64}" ifconfig $_ifs inet6 $_addr prefixlen $resp up || return echo "inet6 $_addr $resp" >>$_hn addhostent "$_addr" "$_name" v6_defroute $_ifs } v4_defroute() { local _dr _prompt=" or 'none'" [[ -n $(ifconfig | sed -n '/[ ]inet .* broadcast /p') ]] || return [[ -f /tmp/dhclient.conf && $nifs == 1 ]] && return [[ -x /sbin/dhclient ]] && _prompt=", 'dhcp'$_prompt" _prompt="Default IPv4 route? (IPv4 address$_prompt)" _dr=$(route -n show -inet | sed -n '/^default */{s///; s/ .*//; p;}') [[ -f /tmp/dhclient.conf ]] && _dr=dhcp while :; do ask_until "$_prompt" "$_dr" [[ $resp == @(none|dhcp) ]] && break route delete -inet default >/dev/null 2>&1 route -n add -inet -host default "$resp" && { echo "$resp" >/tmp/mygate; break; } route -n add -inet -host default $_dr >/dev/null 2>&1 done } v6_defroute() { local _if=$1 _resp _routers route -n show -inet6 | egrep -q '^default[[:space:]]' && return _routers=$(bsort $(ping6 -n -c 2 ff02::2%$_if 2>/dev/null | sed -n '/bytes from/{s/^.*from //;s/,.*$//;p;}' | sed -n 'G;s/\n/&&/;/^\(.*\n\).*\n\1/d;h;P')) local PS3="IPv6 default router? (${_routers:+list #, }IPv6 address or 'none'): " select _resp in $_routers; do [[ ${_resp:=$REPLY} == *:* ]] && break [[ $_resp == none ]] && return done route -n add -inet6 -host default "$_resp" && echo "$_resp" >>/tmp/mygate } enable_network() { local _f _gw for _f in dhclient.conf resolv.conf resolv.conf.tail; do if [ -f /mnt/etc/$_f ]; then cp /mnt/etc/$_f /etc/$_f fi done ifconfig lo0 inet 127.0.0.1/8 for hn in /mnt/etc/hostname.*; do ((nifs++)) if=${hn#/mnt/etc/hostname.} (ifconfig $if||ifconfig $if create) >/dev/null 2>&1 || continue while :; do if [ "$cmd2" ]; then set -- $cmd2 af=$1 name=$2 mask=$3 bcaddr=$4 ext1=$5 cmd2= i=1 while [ i -lt 6 -a -n "$1" ]; do shift; let i=i+1; done ext2="$@" else read af name mask bcaddr ext1 ext2 || break fi case "$af" in "#"*|"!"*|"bridge"|"") continue ;; "dhcp") [ "$name" = "NONE" ] && name= [ "$mask" = "NONE" ] && mask= [ "$bcaddr" = "NONE" ] && bcaddr= dhcpif="$dhcpif $if" cmd="ifconfig $if $name $mask $bcaddr $ext1 $ext2 down" if [[ -x /sbin/dhclient ]]; then cmd="$cmd; dhclient $if" else cmd="$cmd; echo /sbin/dhclient missing - skipping dhcp request." fi ;; "rtsol") rtsolif="$rtsolif $if" cmd="ifconfig $if $name $mask $bcaddr $ext1 $ext2 up" ;; *) read dt dtaddr if [ "$name" = "alias" ]; then alias=$name name=$mask mask=$bcaddr bcaddr=$ext1 ext1=$ext2 ext2= else alias= fi cmd="ifconfig $if $af $alias $name" case "$dt" in dest) cmd="$cmd $dtaddr" ;; *) cmd2="$dt $dtaddr" ;; esac case $af in inet) if [ ! -n "$name" ]; then echo "/etc/hostname.$if: inet alone is invalid" return fi [ "$mask" ] && cmd="$cmd netmask $mask" if [ "$bcaddr" -a X"$bcaddr" != "XNONE" ]; then cmd="$cmd broadcast $bcaddr" fi [ "$alias" ] && rtcmd=";route -qn add -host $name 127.0.0.1" ;; inet6) if [ ! -n "$name" ]; then echo "/etc/hostname.$if: inet6 alone is invalid" return fi [ "$mask" ] && cmd="$cmd prefixlen $mask" cmd="$cmd $bcaddr" ;; *) cmd="$cmd $mask $bcaddr" ;; esac cmd="$cmd $ext1 $ext2$rtcmd" rtcmd= ;; esac eval "$cmd" done /dev/null 2>&1 route -qn add -host default $_gw && break done [[ -z $rtsolif ]] && stripcom /mnt/etc/mygate | while read _gw; do [[ $_gw == !(*:*) ]] && continue route -qn delete -inet6 default >/dev/null 2>&1 route -qn add -host -inet6 default $_gw && break done route -qn add -net 127 127.0.0.1 -reject >/dev/null } install_files() { local _src=$1 _files=$2 _f _sets _get_sets _n _col=$COLUMNS \ _tmpfs _tmpsrc _cfile _fsrc _unver _t _issue _srclocal _size for _f in $THESETS; do isin $_f $_files || continue; _sets=$(addel $_f $_sets) if [[ -z $DISPLAY && ! -d /mnt/etc/X11 ]]; then isin ${_f%${VERSION}.tgz} xbase xetc xshare xfont xserv && continue fi isin $_f $DEFAULTSETS "site$VERSION-$(hostname -s).tgz" && _get_sets=$(addel $_f $_get_sets) done if [[ -z $_sets ]]; then echo -n "Looked at " echo $_src | sed 's/\(^ftp:\/\/[^/]*\)\(:[^/]*\)\(@.*\)/\1\3/' echo "and found no $OBSD sets. The set names looked for were:" let COLUMNS=_col-8 for _n in $THESETS; do echo $_n; done | showcols | sed 's/^/ /' COLUMNS=$_col $auto && exit 1 echo return fi isin INSTALL.$ARCH $_files || ask_yn "INSTALL.$ARCH not found. Use sets found here anyway?" || return select_sets "$_sets" "$_get_sets" [[ -n $resp ]] || return _get_sets=$resp _get_sets=$(for s in $THESETS; do isin $s $_get_sets && echo $s; done) _size=$( ( [[ $_src == file://* ]] && ls -lT "${_src#file://}" || ftp -V -o - "$_src/index.txt" 2>/dev/null ) | ( sum=0 while read x x x x s x x x f2 f && : ${f:=$f2}; do isin $f $_get_sets && let sum+=s done; echo $sum ) ) _size=$((${_size:-536870912} / 1024)) _unver=$_get_sets for _issue in ''; do ! isin SHA256.sig $_files && _issue="Directory does not contain SHA256.sig" && break _tmpfs=$( ( for fs in /mnt/{{,var/}tmp,home,usr{/local,}}; do df -k $fs 2>/dev/null | grep " $fs\$" done df -k ) | ( while read a a a a m m; do [[ $m == /mnt/@(@(|var/)tmp|home|usr/@(src,obj,xobj))@(|/*) ]] && ((a > _size + 10240)) && echo $m && exit [[ $m == /mnt@(|/*) ]] && ((a > _size * 4)) && echo $m && exit done ) ) if [[ -d $_tmpfs ]]; then ! _tmpsrc=$(tmpdir "$_tmpfs/sets") && _issue="Cannot create prefetch area" && break else _issue="Cannot determine prefetch area" && break fi _cfile=$_tmpsrc/SHA256 _srclocal=false _t=Get/Verify [[ $_src == file://* ]] && _srclocal=true _t='Verifying ' ! ftp -D "$_t" -Vmo "$_cfile.sig" "$_src/SHA256.sig" && _issue="Cannot fetch SHA256.sig" && break ! signify -Vep /etc/signify/openbsd-${VERSION}-base.pub \ -x "$_cfile.sig" -m "$_cfile" && _issue="Signature check of SHA256.sig failed" && break for _f in $_get_sets; do rm -f "$_tmpsrc/h" "$_tmpsrc/fail" ( ftp -D "$_t" -Vmo - "$_src/$_f" || >"$_tmpsrc/fail" ) | ( $_srclocal && sha256 >$_tmpsrc/h || sha256 -ph "$_tmpsrc/h" >"$_tmpsrc/$_f" ) if [[ -f $_tmpsrc/fail ]]; then rm -f "$_tmpsrc/$_f" if ! ask_yn "Fetching of $_f failed. Continue anyway?"; then [[ -d $_tmpsrc ]] && rm -rf "$_tmpsrc" $auto && exit 1 return fi continue fi if fgrep -qx "SHA256 ($_f) = $(<$_tmpsrc/h)" "$_cfile"; then _unver=$(rmel $_f $_unver) else if ! ask_yn "Checksum test for $_f failed. Continue anyway?"; then [[ -d $_tmpsrc ]] && rm -rf "$_tmpsrc" $auto && exit 1 return fi fi done done [[ -n $_unver ]] && : ${_issue:="Unverified sets:" ${_unver% }} if [[ -n $_issue ]] && ! ask_yn "$_issue. Continue without verification?"; then [[ -d $_tmpsrc ]] && rm -rf "$_tmpsrc" $auto && exit 1 return fi for _f in $_get_sets; do _fsrc="$_src/$_f" [[ -f $_tmpsrc/$_f ]] && _fsrc="file://$_tmpsrc/$_f" case $_fsrc in *.tgz) ftp -D Installing -Vmo - "$_fsrc" | tar -zxphf - -C /mnt;; *) ftp -D Installing -Vmo "/mnt/$_f" "$_fsrc";; esac if (($?)); then if ! ask_yn "Installation of $_f failed. Continue anyway?"; then [[ -d $_tmpsrc ]] && rm -rf "$_tmpsrc" $auto && exit 1 return fi else DEFAULTSETS=$(rmel $_f $DEFAULTSETS) GOTSETS="$GOTSETS $_f" fi [[ -d $_tmpsrc ]] && rm -f "$_tmpsrc/$_f" done [[ -d $_tmpsrc ]] && rm -rf "$_tmpsrc" } encode_for_url() { echo "$1" | sed " s/%/%25/g s/ /%20/g s/!/%21/g s/\"/%22/g s/#/%23/g s/\\\$/%24/g s/&/%26/g s/'/%27/g s/(/%28/g s/)/%29/g s/\*/%2a/g s/+/%2b/g s/,/%2c/g s/-/%2d/g s/\./%2e/g s/\//%2f/g s/:/%3a/g s/;/%3b/g s//%3e/g s/?/%3f/g s/@/%40/g s/\[/%5b/g s/\\\\/%5c/g s/]/%5d/g s/\^/%5e/g s/_/%5f/g s/\`/%60/g s/{/%7b/g s/|/%7c/g s/}/%7d/g s/~/%7e/g " } ftp_error() { if [[ -n $(echo "$2" | grep "$1") ]]; then echo $1 return 0 fi return 1 } startftplist() { ((nifs < 1)) && return set -m ( ftp -Vao - "http://129.128.5.191/cgi-bin/ftplist.cgi?path=$FTPSETDIR" \ 2>/tmp/ftplisterr >$SERVERLISTALL echo -n $SECONDS >$SERVERLISTSEC feed_random ) & ftppid=$! set +m (sleep 12; kill -INT -$ftppid >/dev/null 2>&1) & } waitftplist() { wait "$ftppid" 2>/dev/null } ftp_time() { local _ftplist_sec=$(cat $SERVERLISTSEC 2>/dev/null) local _time=$(sed '/^TIME=\([0-9]*\)$/!d;s//\1/;q' $SERVERLISTALL 2>/dev/null) [[ -n $_ftplist_sec && -n $_time ]] && echo $((_time + SECONDS - _ftplist_sec)) } install_url() { local _url_type=$1 _file_list _url_base _prompt _passwd _mirror eval local _server_ip=\$_${_url_type}_server_ip \ _server_dir=\$_${_url_type}_server_dir waitftplist ask "HTTP/FTP proxy URL? (e.g. 'http://proxy:8080', or 'none')" \ "${ftp_proxy:-none}" unset ftp_proxy http_proxy [[ $resp == none ]] || export ftp_proxy=$resp http_proxy=$resp if [[ -s $SERVERLISTALL ]]; then _prompt="Server? (hostname, list#, 'done' or '?')" sed -n "s,^${_url_type}://"'\([[A-Za-z0-9\:_][]A-Za-z0-9:._-]*\),\1,p' \ $SERVERLISTALL >$SERVERLIST set -- $(sed q $SERVERLIST) _server_ip=${1%%/*} else echo "(Was not able to get ftplist from ftp.openbsd.org, but that is OK)" _prompt="Server? (hostname or 'done')" fi while :; do ask_until "$_prompt" "$_server_ip" case $resp in done) return;; "?") [[ -s $SERVERLIST ]] || continue less -XEN < $SERVERLIST ;; +([0-9])) [[ -s $SERVERLIST ]] || continue set -- $(sed -n "${resp}p" $SERVERLIST) (($# < 1)) && { echo "There is no line $resp."; continue; } _server_ip=${1%%/*} ;; +([A-Za-z0-9\:.\[\]_-])) _server_ip=$resp break ;; *) echo "'$resp' is not a valid hostname." ;; esac done eval _${_url_type}_server_ip=$_server_ip set -- $(sed "/^$_server_ip/x;\$!d;x" $SERVERLIST 2>/dev/null) resp=${1#*/} [[ $resp == "$1" ]] && resp= if (($# > 1)); then resp=$resp/$FTPSETDIR _mirror=yes fi ask_until "Server directory?" "${resp:-pub/OpenBSD/$FTPSETDIR}" _server_dir=$resp eval _${_url_type}_server_dir=$_server_dir if [[ $_url_type == ftp ]]; then IFS= ask_until "Login?" "${_ftp_server_login:=anonymous}" _ftp_server_login=$resp if [[ $_ftp_server_login == @(anonymous|ftp) ]]; then _passwd=root@`hostname` else resp= while [[ -z $resp ]]; do askpass "Password? (will not echo)" done _passwd=$resp fi fi _url_base=$_url_type:// if [[ $_url_type == ftp && $_ftp_server_login != anonymous ]]; then _url_base=$_url_base$(encode_for_url "$_ftp_server_login"):$(encode_for_url "$_passwd")@ fi _url_base=$_url_base$_server_ip/$_server_dir if [[ $_url_type == ftp && -z $ftp_proxy ]]; then _file_list=$(ftp -V "$_url_base/") ftp_error "Login failed." "$_file_list" && return ftp_error "No such file or directory." "$_file_list" && return else _file_list=$(ftp -Vo - "$_url_base/index.txt" | sed 's/^.* //' | sed 's/ //') fi install_files "$_url_base" "$_file_list" installedfrom=$_url_type://$_server_ip/$_server_dir if [[ -n $_mirror ]]; then PACKAGE_PATH=$(print -r -- "$installedfrom" | sed -E "/\/(snapshots|[0-9]\.[0-9])\/($ARCH)\/*$/!d s!!/\1/packages/$(arch -s)/!;q") else PACKAGE_PATH= fi } install_mounted_fs() { local _dir while :; do ask_until "Pathname to the sets? (or 'done')" "$SETDIR" [[ $resp == done ]] && return [[ -d /mnt2/$resp ]] && { _dir=/mnt2/$resp; break; } [[ -d /mnt/$resp ]] && { _dir=/mnt/$resp; break; } [[ -d /$resp ]] && { _dir=/$resp; break; } echo "The directory '$resp' does not exist." done install_files "file://$_dir" "$(ls $_dir/)" } install_cdrom() { get_drive "CD-ROM" '$(get_cddevs)' || return mount_mnt2 $resp || return install_mounted_fs } install_disk() { ask_yn "Is the disk partition already mounted?" if [[ $resp == n ]]; then get_drive "disk" '$(bsort $(get_dkdevs))' \ '$(bsort $(rmel $ROOTDISK $(get_dkdevs)))' || return mount_mnt2 $resp || return fi install_mounted_fs } install_nfs() { local _tcp ask_until "Server IP address or hostname?" "$NFS_ADDR" NFS_ADDR=$resp ask_until "Filesystem on server to mount?" "$NFS_PATH" NFS_PATH=$resp ask_yn "Use TCP transport? (requires TCP-capable NFS server)" [[ $resp == y ]] && _tcp=-T mount_nfs $_tcp -o ro -R 5 $NFS_ADDR:$NFS_PATH /mnt2 || return install_mounted_fs } install_tape() { local _z _bs get_drive "tape drive" '$MTDEVS' || return export TAPE=/dev/nr$resp if [[ ! -c $TAPE ]]; then echo "$TAPE is not a character special file." return fi echo -n "Rewinding $TAPE (mt rewind)..." mt rewind || return echo "done." while :; do ask_until "Skip how many files? (or 'done')" 0 [[ $resp == done ]] && return [[ $resp == +([0-9]) ]] || continue if (($resp > 0)); then echo -n "Skipping $resp file(s)..." mt fsf $resp || return echo "done." elif [[ -n $_bs ]]; then mt bsf; mt fsf fi unset _z ask_yn "Is the file gzipped?" yes [[ $resp == y ]] && _z=z [[ $_z == z ]] || _bs=10240 ask_until "Blocksize for this file?" "${_bs:-8k}" [[ $resp == done ]] && return _bs=$resp dd if=$TAPE bs=$_bs | tar ${_z}xvphf - -C /mnt || return done } set_timezone() { local _zonefile=$1 _zonepath _zsed _tz _zoneroot=/usr/share/zoneinfo [[ ! -f $_zonefile ]] && return [[ -n $TZ ]] && return if [[ -h /mnt/etc/localtime ]]; then TZ=$(ls -l /mnt/etc/localtime 2>/dev/null) TZ=${TZ#*${_zoneroot#/mnt}/} fi waitftplist if [[ -s $SERVERLISTALL ]]; then _tz=$(sed -n '/^TZ=/s/TZ=//p' <$SERVERLISTALL) [[ -n $_tz ]] && isin "$_tz" `cat $_zonefile` && TZ=$_tz fi [[ $_zonefile = /var/tzlist && -z $TZ ]] && return while :; do ask "What timezone are you in? ('?' for list)" "$TZ" _zonepath=${resp%%*(/)} case $_zonepath in "") continue;; "?") grep -v /. $_zonefile | showcols continue;; esac while isin "$_zonepath/" $(cat $_zonefile); do ask "What sub-timezone of '$_zonepath' are you in? ('?' for list)" _zsed=$(echo $_zonepath/ | sed 's,/,\\/,g') resp=${resp%%*(/)} case $resp in "") ;; "?") sed -n "/^$_zsed/{s/$_zsed//;/\/./!p;}" $_zonefile | showcols;; *) _zonepath=$_zonepath/$resp;; esac done if isin "$_zonepath" $(cat $_zonefile); then TZ=${_zonepath#$_zoneroot} return fi echo -n "'${_zonepath}'" echo " is not a valid timezone on this system." done } sane_install() { local _q=$1 _s for _s in $SANESETS; do isin $_s $DEFAULTSETS || continue [[ -z $_q ]] && ask_yn "Are you *SURE* your $MODE is complete without '$_s'?" || return done } install_sets() { local _d _locs="disk ftp http" echo [[ -s $SERVERLISTALL ]] && _d=$(sed -n '/^method=/s/method=//p' $SERVERLISTALL) ifconfig netboot >/dev/null 2>&1 && : ${_d:=http} [[ -n $(get_cddevs) ]] && { _locs="cd $_locs"; : ${_d:=cd}; } [[ -x /sbin/mount_nfs ]] && _locs="$_locs nfs" [[ -n $MTDEVS && -x /bin/mt ]] && _locs="$_locs tape" : ${_d:=http} if ! isin "$_d" $_locs; then for a in http ftp cd nfs tape disk; do isin $a $_locs && _d=$a && break done fi echo "Let's $MODE the sets!" while :; do umount -f /mnt2 >/dev/null 2>&1 [[ -n $method ]] && _d=$method sane_install quiet && _d=done ask "Location of sets? ($_locs or 'done')" "$_d" case $resp in done) sane_install && return;; c*|C*) isin cd $_locs && install_cdrom && method=cd;; d*|D*) install_disk && method=disk;; f*|F*) isin ftp $_locs && install_url ftp && method=ftp;; h*|H*) isin http $_locs && install_url http && method=http;; n*|N*) isin nfs $_locs && install_nfs && method=nfs;; t*|T*) isin tape $_locs && install_tape && method=tape;; esac $auto && break done } update_firmware() { echo "/usr/sbin/fw_update -v" >>/mnt/etc/rc.firsttime } munge_fstab() { local _dev _mp _fstype _opt _rest while read _dev _mp _fstype _opt _rest; do [[ $_dev == @(/dev/vnd*|\#*) || $_fstype == nfs || ! -f /sbin/mount_$_fstype || $_opt == *noauto* || $_opt == *xx* ]] && continue _opt=$(echo $_opt | sed 's/softdep//') [[ $_fstype == ffs ]] && _opt=$(echo $_opt | sed 's/ro/rw/') [[ $_fstype == ffs ]] || _opt=$(echo $_opt | sed 's/rw/ro/') echo $_dev /mnt${_mp%/} $_fstype $_opt $_rest done /etc/fstab if [ ! -s /etc/fstab ]; then echo "Unable to create valid /etc/fstab." exit fi } mount_fs() { local _async=$1 _dev _mp _fstype _opt _rest _msg _fail while read _dev _mp _fstype _opt _rest; do [ "$_mp" = "/mnt" ] || mkdir -p $_mp _msg=$(mount -v -t $_fstype $_async -o $_opt $_dev $_mp) || _fail="$_fail\n$_mp ($_dev)" echo $_msg | sed 's/, ctime=[^,)]*//' done 0)) || continue echo -n "fsck -${_f}p $_dev..." if ! fsck -${_f}p $_dev >/dev/null 2>&1; then echo "FAILED. You must fsck $_dev manually." _fail=y else echo "OK." fi done /tmp/resolv.conf for _ns in $resp; do echo "nameserver $_ns" >>/tmp/resolv.conf done cp /tmp/resolv.conf /tmp/resolv.conf.shadow fi } populateusrlocal() { if [ -f /mnt/etc/mtree/BSD.local.dist ]; then /mnt/usr/sbin/chroot /mnt /usr/sbin/mtree -Uedqn -p /usr/local -f /etc/mtree/BSD.local.dist >/dev/null fi } apply() { if [[ $sshd == n ]]; then echo "sshd_flags=NO # disabled during install" \ >>/mnt/etc/rc.conf.local fi if [[ $sshd_disableroot == y ]]; then sed "/^#\(PermitRootLogin\) yes/s//\1 no/" \ < /mnt/etc/ssh/sshd_config >/tmp/sshd_config cp /tmp/sshd_config /mnt/etc/ssh/sshd_config fi if [[ $ntpd == y ]]; then echo "ntpd_flags= # enabled during install" \ >>/mnt/etc/rc.conf.local if [[ $ntpd_server != default ]]; then set -- $ntpd_server sed "s/^servers /#&/;/#server /a\\ servers $1 " /mnt/etc/ntpd.conf >/tmp/ntpd.conf cp /tmp/ntpd.conf /mnt/etc/ntpd.conf fi fi if [[ $x11 == y ]]; then sed "/^#\(machdep\.allowaperture=${MDXAPERTURE}\)/s//\1 /" \ /mnt/etc/sysctl.conf >/tmp/sysctl.conf cp /tmp/sysctl.conf /mnt/etc/sysctl.conf fi if [[ $xdm == y && -x /mnt/usr/X11R6/bin/xdm ]]; then echo "xdm_flags= # enabled during install" \ >>/mnt/etc/rc.conf.local fi if [[ $defcons == y ]]; then cp /mnt/etc/ttys /tmp/ttys sed -e "/^$CTTY/s/std.9600/std.${CSPEED}/" \ -e "/^$CTTY/s/unknown/vt220 /" \ -e "/$CTTY/s/off.*/on secure/" /tmp/ttys >/mnt/etc/ttys [[ -n $CPROM ]] && echo "stty $CPROM $CSPEED\nset tty $CPROM" >>/mnt/etc/boot.conf fi ln -sf /usr/share/zoneinfo/$TZ /mnt/etc/localtime } questions() { local _d _xdmask=y _def ask_yn "Start sshd(8) by default?" yes sshd=$resp ask_yn "Start ntpd(8) by default?" ntpd=$resp if [[ $resp == y ]]; then ask "NTP server? (hostname or 'default')" default ntpd_server=$resp fi def=no [[ -n $DISPLAY ]] && def=yes if [[ -n $MDXAPERTURE ]]; then ask_yn "Do you expect to run the X Window System?" $def x11=$resp _xdmask=$resp fi if [[ -n $MDXDM && $_xdmask == y ]]; then ask_yn "Do you want the X Window System to be started by xdm(1)?" xdm=$resp fi if [[ -n $CDEV ]]; then _d=${CPROM:-$CDEV} ask_yn "Change the default console to $_d?" defcons=$resp if [[ $resp == y ]]; then ask_which "speed" "should $_d use" \ "9600 19200 38400 57600 115200" $CSPEED case $resp in done) defcons=n;; *) CSPEED=$resp;; esac fi fi } upgrade_to64time_t() { /mnt/usr/sbin/pwd_mkdb -d /mnt/etc master.passwd >/mnt/var/log/lastlog >/mnt/var/run/utmp } feed_random() { { (dmesg; cat $SERVERLISTALL /*.conf; sysctl; route -n show; df; ifconfig -A; hostname) >/dev/random 2>&1 dd if=/mnt/var/db/host.random of=/dev/random bs=65536 count=1 } >/dev/null 2>&1 } store_random() { { dd if=/dev/random of=/mnt/var/db/host.random bs=65536 count=1 dd if=/dev/random of=/mnt/etc/random.seed bs=512 count=1 chmod 600 /mnt/var/db/host.random /mnt/etc/random.seed } >/dev/null 2>&1 } finish_up() { local _dev _mp _fstype _rest if [[ -x /mnt/sbin/swapctl ]]; then /mnt/sbin/swapctl -a /dev/$SWAPDEV >/dev/null 2>&1 while read _dev _mp _fstype _rest; do [[ $_fstype == swap ]] && /mnt/sbin/swapctl -a $_dev >/dev/null 2>&1 done $/\1/p') md_installboot $ROOTDISK if [[ -f /mnt/bsd.mp ]] && ((NCPU > 1)); then echo "Multiprocessor machine; using bsd.mp instead of bsd." mv /mnt/bsd /mnt/bsd.sp 2>/dev/null mv /mnt/bsd.mp /mnt/bsd fi update_firmware upgrade_to64time_t store_random cat <<__EOT CONGRATULATIONS! Your OpenBSD $MODE has been successfully completed! To boot the new system, enter 'reboot' at the command prompt. __EOT [[ $MODE == install ]] && cat <<__EOT When you login to your new system the first time, please read your mail using the 'mail' command. __EOT md_congrats [[ "$MODE" == upgrade ]] && \ echo "After rebooting, run sysmerge(8) to update your system configuration." $auto && >/ai.done } ROOTDISK= ROOTDEV= PACKAGE_PATH= SM_ARGS= SM_ARGSX= SETDIR="$VNAME/$ARCH" FTPDIR="pub/OpenBSD/$VNAME" SERVERLISTALL=/tmp/serverlistall SERVERLISTSEC=/tmp/serverlistsec SERVERLIST=/tmp/serverlist WLANLIST=/tmp/wlanlist FSTABFLAG=-f for _opt in d f l m n p s; do ulimit -$_opt unlimited done dmesg | sed -n '/^OpenBSD /h;/^OpenBSD /!H;${g;p;}' >/var/run/dmesg.boot FTPSETDIR=$SETDIR set -- $(scan_dmesg "/^OpenBSD $VNAME\([^ ]*\).*$/s//\1/p") [[ $1 == -!(stable) ]] && FTPSETDIR=snapshots/$ARCH MTDEVS=$(scan_dmesg "${MDMTDEVS:-/^[cms]t[0-9][0-9]* /s/ .*//p}") nifs=0 DISPLAY=$(scan_dmesg '/^wsdisplay[0-9]* /s/ .*//p') CONSOLE=$(scan_dmesg '/^\([^ ]*\).*: console$/s//\1/p') CONSOLE=${CONSOLE% } [[ -n $CONSOLE ]] && CSPEED=$(stty speed /dev/null 2>&1 for _ifs in $(get_ifdevs dhcp); do set -- $(v4_info $_ifs) [[ $1 == UP && -n $2 ]] && continue ifconfig $_ifs delete down -group dhcp 2>/dev/null done get_responsefile() { local _f _ifdev _mac _mode _server _lf [[ -x /sbin/dhclient ]] || return _ifdev=$(get_ifdevs netboot) if [[ -z $_ifdev ]]; then set -- $(get_ifdevs) (($#)) || return if (($# == 1)); then _ifdev=$1 else while :; do ask_which "network interface" \ "should be used for the initial DHCP request" \ "$*" isin "$resp" $* && _ifdev=$resp && break done fi fi [[ -n $_ifdev ]] || return dhclie P PPH[P 0\00@0Zr -@`L#0p00 0,0< (0P z@P T00ӧ2 0 o3Q00 㳨ժX@,"Z@- 00,7Z0  ,7 -<0@L 4  @     Z p-LP`@@P`p p-@L0`S 0 P p00P@0T * 00p00@[X0T0@` DA A000 0@@P4787ZܥZ -RL0pS@3Q0@A00T2 P- T<2P``V 0T0 XQ P@0T*00T+ T4 T- T: 0DSLQB`1 P1 R|1@` DA ~A000 0@@P41P``(P``Q 1{`p`3)P``0  0{`p`3TEP0  0BS Q` L M`P H040R@0@ `w4787|YZZRhR|RRR -PPLML H00@!@1  Q@ - EQ5 Q 1P AQ 0 S P0AS0KK0K@K0  /P 0  QP 0x  X\ 0KT  0p @|= @0@40 8 < |ԭ@0l S` 0P0=URʨMUq0KU t tt 0KlpP `p1@U@PBPUt  t 00K00Sb h7 7P_ {P0Cd0 N0 Sh \ i d0P 7@Tz`0pSr 6 (P0@@P0 &00P 6 |P  U:t@f DA @z&A0P@0`P||P T1@@ f %z)]%0S d0S  O\Q\ hp p0\p Sx5 J ED5@f DA yA`P 5 %h t0K 5t P<@40PT*$! <@ <@40T*4lp  `<@ S P0 ylpP`t E@P $y  0 0 4 3  PwU*00Pp3@f DA yAP`@@3  &0U0;0g0S7<80 0c0S783 RC0S!3 P<- `X :2@g DA LyA@p`@ 00Uap0P_vP|t, <80 0c0SX2 R40\?*(00< f d P;PppT;p f yd OU8h1@` DA xA @4@ @8 < ,8(1@` DA xA @4@ @8 < 80 @` DA xA @4@ 8 < 0@f DA xA`P)P806`t w0UuP} uPx |uPLrZ4787 xY X X ] ZX"0@0Sb0"0 0S! 0!@ T! ! !0PU 000 !  0S @\)| t!}0S00T!uPU 0 RH80  RX00  R(l0  R L0 R^FPfP ^@D@TY00S@ l7tH([ (0 R00PP0XZ P-L@ 0 p-D`L0@ PR  a+ e 00b 0p7 p-@QLP! R `0 Q 0Q 0  + 000pT`  0Spp0 a+ 00 07 0-hPL@T\@D P0R  P 0,0 0S0C00004H7?7 0 0  U+7PH 0-4@4P0L H+0 0 07HP `,0R- 00+G7?P0 0ࢿdH`HZ -pPLP@`0e R0@0Q~0U0C0P 00 0b@A~0U00P 8~8 0U00.~0U00PXH\H -PL@4M<$< 0,4<<0 pP@p WV0`@T3`VG3 Vb 4 у 0U{3# @<0S 4 _QQ„ V^00@0!0<0pWS0N 040  VP\ 0SYW00S4 0 Q 0 V0WP ژ 0?, PÐ @ 0 ` 0f S,0 0P0@  D `~@TD b$2`?ÐY 0@m 0` S PPT M0 V0 0C V00@p40 W0040  V080   0Q00l 0C 8 00@!V@8 0P 0 qS 0S  F}000PU@08 0S  +@R<@ P0S | 0 $}0@0004S  , 00c0(KP @>@H7hHxHlHXZ\HXH|H -`0` \0@L \T | |$0$  0 xHtHlH\HXH|H -,@L0S V_0000LHLZ -L|hT} 0- P@L?_0h;_LZ -L0L @R TT^|@@$h| |@XZtw 0-@P LZ 0 00h p-X`@L;_P7_ Z0 0 pLZ -LM@Pa0SW P 00|q$K(K0 @,K @w`PJ (1 ($9 $0V0 P,0AP|\ wP#U0( bQ P0P00Ť0 00 @@ K lP P4Q (0Ph@@6P`77( @H4H8HDHH -L MK0 K @KK @qw@P {|xK -L$M@PPb0S S P 00吢U0 ,K0K4K8@K @[tp@0 P0C 0 ' D0 P[L$0P埬@H7լ.Pը^0l0ŠnN cR0N 0NRtN lNh.0XP.X  U  U0  c> B > . >.@@LEvQ4  P 00 S 8v@t) R ] 0S 0S 0S# RPH \  L 8-0 0 @[00,QB T00^@  T  0 TPPU Qb Q < R B 0AL c0  "P< 0S P"0S S S00j000S 00LPm0 x  T00e ˟0  @0 000D S` `˟Q\;X;  H;  @ T " +0000010DS 00D 0 1:ʟ @ T  *0 00D Sp 0!0000C00 T T`` 0(*TT 0T 0T :'Q{  :@ 9 R 0  R)l9@ M0 0 0C0 TT70  R@9 ^0 0@0$0  00^u@t }t {tu R8 0 R0W $8PȟȟH yP0S cQsQ CQ d8P#P8 po8   0 B y T TPP& '10DSP00D P 0iǟ`@` P 0 S0@ @@NT t t ttH0 SD Q  6D 0 0 (Kt&0SLƟ00*Ɵ0 ( 0A00ct P$Is\@T] P6 D 00`0 0Ɵ 00@m5@T5 R@0T 0T 00ST  R %PTd`  p   b,P% #@E! 00C0>0 R84 0@ L4 P 3ß P @ğ@$a00@yP P. pc00v3! R|S0 0CR4#@0#Q@3 $ß0 @0S 0P0 0ż/ 20P~ @ R B0 0P0 0 з0C 0 0QH2P0" @0S 0 ` a1 0 f0b 00R0bP0`l"2`<0 @0K0` 0PFP @ `v}PE`X@ ڰ 00z P  aU 1 0Pc 0/T PP  XPx\b,10cSsS8 CS6 2 rP aX )0  c 00 0;HH? X|S 0R KS| izzw -LGMđ0Pp,0 g 0S@`KS@' ,S0 0,SSBKHH j ,> 0/FpP; IKAfp: ~|41` V,0@SV1S   Q RQ\ ^00\0S l|`, 0R(KD| 8q~S~ $k~|iX{8{{${zw p-L M`P 0(0P`0,P 4@0 0 0 L400 PPKp{xt{4z p-0St0``QLP @3!   @~@Q0S pQ{i{ -LMMMNnK`F0`F@/㸀K,0 prO[K mO"K hO dO Ka=!0,2 0 (2 $ UPP6NK@  0= 0 8ONK@D0@D ,2 ( $B t t U@ 1O -O  )OT NK@x(, 0R(K}ip(B¨{t{{x p-LM`0.^K@/0 Oh0 ,K <P0 HUPKH 0RKpy}ibp'B¼{x -MLMD0PQ,0 p H  'GP +N |CTPJ cT zT0UCTUCKHH/N2"2CT(K! W`` 0( K@V0@  1 吡 W00 S[K=00 'U@ Ntg  A, 0Rb(K0[K PK`uN qN10 x1 pQ |a T@PJt1S* 0 |1 x! pq  0ZDp@8 JKAA}p6 |@4[K 1 >N0 D1 0Ch! |A x1 @! lA pq 0  *NPz||Jzt|phBz`| T|| @|i|tbp&BX|{{ |h|$x4|P|{${ -LWM 0`(0 pXpP* OK/M ,` xT@P"YnKK`F./M0$K0 ᳀ r cTP7|( 0R $KD, I| 40y(A|$yix|BbB$B¤||4x -ML M/NK0 /`q(0 M0 2 )T@P0K00S$^^KPE PE2KMP 00@S,yM0x 5 @C TP V( 0R$K({$&{ibp B"Bø|@x| p-LM@a0_K@/0 FM !0d0C Sx  h  h h h h h h h h h  h    Sy0$0 0 SP-Kr0gS 0R|| 0RKp0$0 0$0 0$0 0$0 ({$ib|p#Bl`U||Tx -\LM0OK /,0 L4&4Ɵ0 (3 vS@P 0Sw ş, 0Rv(K;K!0SjKA AI  I , L%ş0e6 9u4 (K0P)|0PGS@PO)R KLP9S (K06PK8C8sj@K 6K %YL( K0S3S4 , $    dQt $4QppA?KK $:L3s s 4 R K Kj>C^ c^ KP6KjK 0K@K p>3S b'}KpGpG`/HL#09 9 g 7 RP7S       p G 3CSL GW`3 Rt  K >L#(KH0( K<#(KFK(#K6[SW V@K :6[SI PK 9 0KχKݺ2 RK3`S)0 S) "儢 7K p"K3CS GWK@H"H2K@<840,b=a;b9b7b5a3PK 9V@K 90K@!PlKT  0P儺OK0K0@!PYKC^+p 0KKjKX!MKPPPP!P1g 3S0C9 $  0KKK6KjKR3S9 yyy ibp B(*"B8}\}}}}b}!B \~~bP}@~H~P~8~,~}$~l}d}}t}p~h~}~}D}0}}} }(}}~||`x -L`M0xpKP `(0 9:@KP @@.P8KP @|K< |\ ( 0 R$K|K< m|\< b|i~hx -MLM 0/KA A ,0 + POKℂ/J;lr 3K; TK00 PQP2Sd St ZNK@D@D/J0 5 C0@3S3& # # # # & # # # # # # & & # d& # # # # # # # # # # # # # # H& & % % # # # % % # p% P% # # # <% 0% $ $ # $ $ $4p$0cP1 @ P`T ?K P?tp0 Q"#U U U U0 @ 0@0 0@0 Iu4 {#0 @P`0# 2 q3 m1 K@"3R_ 0%u Xl3x#SX#8 @P`# K8303 G0@P`B(3 >0@P`92@ P00@ S` . 0K@ C2S8#82 "0 @# P `" `"0@P`D" 0@P`02 02 " 0@ P`" ! 0@P` 112 1 /x, 0RB(KbV=  SV08LcSp= 8..K0@ N@P2K1" 0`V V"h 0@0 P #U]tZt|WttTtl0 D0Ot\4 viȬp b+|xĀbbtx|Bbx4 | -LP -0L fidH -L M@PmO!ὒp1` fRp0`S.S0C  " P5 A1!O @_@P 0GP (KQ0`S.Sp0C  .S W000 4K4` 0p , [P m00CV꘠@0@* ?Tᚐ)Ac 0TPS0C Px0T0Ct0PS0 C RY  þ( ȬgfffE 0-,@,PL(  dil -LM  QP: K -p* 0#4 BP; K p 0#4 `[KUPspsd@dd d0墵TsO @,8 ,0唵ЁāTVx]$ -L$Mp L QPP= -QPv 7PD H 5b e0S㨂 <@P *ڀ2WTT p gs PY&u $u(KT000>P@Rs@LLskD H huH0SS %PKZ00X ᏑP8(40!Ϡ @0`,`?AlN3c @K@@ Q !Q0 0l0 \0 0XPCP <0 e 0,0 00 0 0 0ccb4 0-\PL0S S0@ S 00@0)cb -LNM`0\(0 0P S:NKXT1*D1S8 @1Ho@RPa0P Sv` .`P V?K嘆P 4P=@hF@( 0R$KP.@JOK I`$ (0Rpp31<`$ (0Rpp&$/`0D S񟗯A A A t? t? t? t? t? t? t? t? XA A @ O `dOPpp`VOpPp`IOPpp`;O`/Oppp3`" Kc p-L|`P0S @PP 0PS pc p-LT`@0S PkP 0@S pwc 0-@PL+TlAPX0H0@ R0S(>:x]cc! -0L idp-0 CR 0R0 SG00 -PTL8Mp`@MPP NP@"pp3&@pK0K`< , K00 @` }@@P,00,0 J9PPm , @0< ,0 0 @@b@P \noXK 3?pL0T PR0T0 T0@`5K,0T@X >\P <\00S \ 0   \PPI40[S  5[0Sl|t ዯ`@L0VU D00S8 W $(K+܃  -0L $id -0LAM @Pp  Bp sPp  8p0` fRAT @SPNKPP W.i@PPnnidȬ$ -@LM `P%@ !@00 Q03*,  0,, pW00P0 U 00 @ep 0 -P02@0P5 :0-P *0@@,0 PdW p脧 0-LXM@P% @\@0P00 lK-럟`00\0P0  :]2K0)cc -LXM@%\@0P00 hK-z\00X0P0  :n82K)cc -Lp`,P3*@P04`0K*K0C8M4>K0C4A=K(0C4$QK 0B*K44(I C:K$$P0B*Kp(I4 0 S9M R M R R R R R R R R @P LR dR 40S0000 0 0*$(p 0%  (00?0bS fS)0S00 < 4<̠Č8#Č:K"̌,K$,4, ,*K 0$880Si0 0000 0 0:K P$ Z0`<`:KdK G(pM0`04Z@` 0  0Kj P T d K:P @T`P d "p@ d0Kp @T ` 0`*K@yV@ 0SS h8+P 080(x0 0S$k $@`PO dK %,dK<K-.3[0C3K:K3[dKS3dK H. R)0S S S"Z  Z:Kp0S   p ,<4("4!< 03[0C3KA3[Sm0`$j0V0 0000'0S<0 00S 0SU0000 0T`0 000 00S0T0 0-0 000 000 0(K0` p-PPL^@00*`,(@P L00040P0 ''@*p M -L@M` Pc= _=0 \13000 55:W00000 0 S,0 ,, pW0000P U>*0  0 @ep 0 -+P02@0P5 :*0 $+P $*0 @@00 PdW p0@ TP3 : 0S 0 0@ 0@,0qU dP"(K舧 p-LXMP@`"0 |P0P00 pK*발d00 `0P0 @@ :f@ m/T  00圜@Kp)s,s 0-LXMP@"u P@lK*|`00\ \0P PP :1@8/T (0 g@00SK0)s,s -L@"000  Ph)G-M T 0 $0@(@ P,P`0`p 4p@0Tp  <0P<` 0Ԣ($ 0,($0P00P4@ h ! @(`$, <@0g\ P. 0@!g.,P(@T<@`0$ 04@, p$0( 04$(0Dp4pHXLP @ @0 ! 0@!0@ Q18 P!@`!@08P! LPpHI$PDHpf.. 0 p 8D0#Hpj!E$ 0#j 0P%@@X@ 0H @^LP@D PpX  `DHL@PPT@00P0 00 pD0 00H000000000 L@000 PP`000ЍG-M0@ Q0@0@0@0@0@0@0@0@0@0@0@|0@t0x@<0@@408@,00@aAq@P `(p08! AQaq ,0d481Q   0p^P0Qp nt ^Q nt 8tP@ t ~ 8tPp t 8t0P0L0#,0 #(8 , 4 #@ H0 < D H #",#,L P H .(#T X H "D0\ #<`0 D d "(h D0l #4p0 @Dp.\..40[8[T@[?  08^P0Q8 n< ?^Q@ n< 7<P@ < n8 7<P8 < 7<0P0D0#<00 , D04 #880 @0D#\#.pT.l0[#4<8[0@0 @P劐pP0(Ko: 0-PL@ 0#<00#800#400 R0 0h7 -pRLPw D@A1>0O `cWP: 5@1@ T@D SH0 0@H0L@pf.5@1 0S@DBR@H0 0@H0L@@00 @TpG†@0D@ S H00 @H0L@`W W  P5@1 0S@D RH0 0@H0L@ \00-PLP 7@0@0D@H0L@0 -RL`? D@A1>?0( @PcXPp: =5@0!0@@0D@e`.5@0!0@@0D@T@00 @@0D@@H@?X X  P5@0!0@@0D@ D00-PLP 6@0@0D@0 -LXMP`@dp 0+PZ0 S 0U 0p xK_$d0 s000Jl00d0 KQ`0 S0$00DS$0 0!$0D -MLM`p# PP' 0V0 BNK@D@D 0PP0 Z P4 W\  9 /6`p  P#$K@s  -L0M`PpP) K.0 P 0S ٕ0"S UD@K 600 KBP(@嬁u("(04"48#K -鈑LM`, W0RSd0 S SMZK hP0U UP SBU U8p UpK0C*KK0C*K8K8R-K( B( C:KԨبpJ( A((0B8 8PC 0 SdTKpPh rS-@L`P"@3:@p 0P@5@3p 0-@LP 00>,@r.0 > 0hsXP0, 0-@LP 00>,@r.0 > 0hXP0, p-LM 0`|>0tr.@l>PX>\00SgP  0`P@>KpXP0,T 0- 00@R@ @0hb>tp 0-0@LPW> 0 0PQ>0p p-LM⡐`  0nxPP  `0cP@ 0` 4P0S( ~ 000x蜈tl -LMT@Pp ( K0 PE$0(SA`@P0S0P0S0 @K  G CP0P@S0P0S0 P0S0$P0S0 (((0$ 0cR00  Kt -LM, `p=00S`P` 05@KVP300K ,PK50K0 0 @KP@@ < yX0PP`U4@0PY`=v3(Kptx -LMK@$@, ;P@ Kx -LM`=00SP x@K0 00 200K娻 H KD+@0 @ +P,@@ ?=Kptx -L0Mp, `)=00SP`' 0Vἀ,K,0PP@1@#TPK 10T0K@h  4K04P 0@ P`T0PU8@0P0S`<v3(Kptx -LMK@$@, ;P@ Kx000 0 000ᄋ -LnQS(0  hH00 -0LM0@` @0s 0P$pK L$ P00R0SP :R Ur 000RPU$ @t 0-LP@P 0 S Sp00@ r 0R <P  0豎000tn -L0P贎 -MLM3PP"0, 00S S0B,0 , 0R-,0(K0  CCP  .@PRnK`F`FKK,KPe00(K踈` -ML MpPP#1, 00S S0B,0 , 0R,,0(K0   C CbP ^@PBnK`F `F2K,KNP 00(K踈` -LM@`p@P0 P@ Pp-K茧Ĉ -LhMP`p@2  0 P0 S 0  0xKd0 s׍l00d0 K -LPpa`@P d000S@  S@ @p080400<0 0\0B謒 -LM@A0p8`PDH 0P' A0S#XPU H 0-0KR0,0KI00SR I0P P,KazP0,K j- -K-K -L$MP` LK 0 Sh S S A 0R0R0TS@0SQ@0S  4K*K0C M8>K0C8a=K(0C8Q=K(0C8(P 0B*K88 C:K((40B*K88( C:K( 0 SP D h D D D D D D D D  $ 40P0 P 0000 SL0SRL0S 000 00S0  .V S:V` 00FV08 KPw40p@P  `p 8K pP@L뀋0 00kp 0x (00?0bS fS0S4 0R  0 :K(45<*K 0880S 0RPX:K P(t 0S<`:K(05`P0`0*K84pL*KpK )p/0`0>:K8S@ p K%P@pH KP TpH KPHK 6P`P l p@p0Kp @ T HK 3p`*K@QV@P`0S 8P 080(pw0 0S$0P04 $`B@P  pKpKHKnK`F4[0C4K4[pKS:K"r_*KpK:K8"`VR0S SL- S SG6Z:K %<*KP8*K$"2Z0*K}P**K Gp#:K ZY:K 6*K Z Y :K (*K p 4[0C4K4[S@$ T>0 000090S <L sp`+0 0+0S00 S0S0P@00 00 0P0S00 00S0P0 0 -0 000 000 0'`(K` -L@`pP 0I@{ -`PL@ىP00mpPP d0T04@0 T0L0`P0 VSPpx   -LMB^KM`PE@p x0OP 0 @j@P <00+PP<4p8?@ K -L@P 0@0B -LMBKMH@`Hp 0 S񟗶  l 0D00W0 pS048 oP@ 00 00(S 000,@P. @p0S( 0S%$ 00D0 0 0S00< S00<000D0s00 0  00($p-0 0 ?(K -L@`p6P 0@, -0-LPM@a?KC/_K@0 Q Q (06Kp@ `@ /),0 pK\ L0 ,P l  K0 -L1M`0pPKA4 8 0 p 1S01 R rP 8 00000C00S3P0 r [000%R@QgQP'eQG*GQEQC*9Q0Qk*%QA *QP Q7 AQ6 DQd[Qq OQf XQj LQBcQLP aQ!pQ jQ3 hQ4 iQKnQ LlQ1tQ6 qQ1 sQ xQD zQ. uQ=PP0SP 0S0 0C rK@@0hS@@0lS@@L@@ 000C @0 w 0# t@K0lKl"K60^S  0J_C0 S RJ!- JK0P-S ]S S@Q00]Q0SJ_K0 RLP8"K @0 2  0p0p@  0p p @p p 0Oq '000 @ 003  P0S P0S P  00CS0P0 r T000U񟗶D Ь X  PT0*0PdP # 0hP P 0zP 4p4 X P0P0CU  SP U/0(K 01SSU$@P0X0C000  0SP Ti (K001SSPTd 43p043 HX @ 0@ B0T0  RP 0 r U000 'P@ 0C00X0  0ScP 0 r 000 4 0d p4 dT0HʏKS8SJS0 9R 8R%*0R +R+ -RH(XR+ A0BSAaR>:fRxR:0PI0 J"00003 J000S03 03 S  :J   60K0UI0 0 0CS0000PU  ?K0CUUɥUXPxPPE¥ ;-0 80#80#   0p@  0p 0p @pp4# 4# 8 0`_ H?K8RPPJ,0 9R 0RJ#*-R .R +R!ER eR  J  J9S:J0 0CS0000wPX   _K@PEtLT-xePEP Bx?;0 8I0p@ 8a0p8%0p4# 4# 8S 0e4P4 4(Kt -DpL0`S@Ps 0@Ss蔻 -L M0`ჀpBX?0S 0@P03Lp @ d0P0!Lp@  '_@  b%$K -Lpp p'  @0S1'*p7@ @0S1 8CX0 8CXp@  P 1 A P<70  c`<7 p, 0R<000`< & 00 0d P`V U00D< 0DO/K<' D %2 <>&B aP`< <'O?KPbdU87L7 Z 0K⠡K)0KL7 < P)0[Lp'PS*0[H H SHH  t' ,h7H@lT`$H` \0 R0\0 ` xdK PK@DT 0@` \0 0R\0 ` xdKPpK)0[S )0K000`  \0R0\0 ` xdKPZK*0[S 00+0K+0K000` \0 R0\0 ` xdKPBKtP,hH'@bTT`$H` \0 R0\0 ` xdKP'K@DT 0@` \0 0R\0 ` xdKPKL7@eT`$H` \0 R0\0 ` xdKPK@DT 0@` \0 0R\0 ` xdKmPKp <!` \0 0dQ,ާd `'R80S\:000`  \0R0\0 ` xdKDPK87Sp 00d`  \0R0\0 ` xdK+PK80@cTjP$(` \0 R0\0 ` xdKPK@DT0`@` \0 0R\0 ` xdKPxK8808 a<0<'XG0bT@T` \0 R0\0 ` xdKP[KX? @cTkP$(` \0 R0\0 ` xdKPCK@DT0`@` \0 0R\0 ` xdKP.K<8X'P< p7 00d`  \0R0\0 ` xdKPK<0<8G0`T@T` \0 R0\0 ` xdKPK8?@cTlmPʡ(` \0 R0\0 ` xdKhPK@DT0`@` \0 0R\0 ` ҂{8'Rp7U <d01K01K>K000` \0 R0\0 ` PxdK9PPK<T'0B0` \0 0R\0 ` PxdK$PPK87T@iTܮ`2H` \0 R0\0 ` PxdK PPK@DT 0@` \0 0R\0 ` P <00`  \0R0\0 ` PxdKPbPKXK\` \0 R0\0 ` xdKPOKp'* h7H@lTaP"(` \0 R0\0 ` xdKP4K@DT0`@` \0 0R\0 ` xdKP H'hl1R 0aR\0Sl  xdKP 0㤐K`0 \0S xdKP0`0 x'0@0l7 yp 00lw PY ĥ@P 0KP DT8 Ml(K谧 -DpL0`S@P5h f0@S/h蔻QRP000S0 -LV`P\' @ 0S\00R001S @  T0p@ 0\ (T0Wp@d 000X7'T00S <0@@ \ 0 07<) -LMGPPX 00z`10>CNKTa@D @D 0P3KHH k p* T0S \PT3 4`K XpxgK0D@K0@3[<3K03K\ Tl  (0!"(80S *y00 @3[P3<8 P@<0X0P(K  0- L@RpP  Ep  |Ep  @p x0$S x@GxP@0 p-`PLU@`cP`0h`  h0S0#*P0h``0p -AMLM8pK`d P(K,0SF"[3RB2[S?2[p< : 8 CNK"[ @D0@DD0H  ,0S+#[<0R'#[80R#@P2[  xW0 02["[[AmK0`F@`FT@D,Pd 00S  rx00 K -L0MP`XKphw0S&P l0`d 0Cpc@ pUw0SPNw600 l d0 0Rl jvp ?w=w@E9w0@05w0SZ 1w0 S-w00RL 0,1\ Yd0(0`0$0` D0 0 0A R  0$ (0 7H0S H0000DP* P0 P000-0 00000h S?0000 00000000 0 0p (K -L@`paP 0F@W -BMLMp`MPP& 0 0<@K*00  X`\`TpmK`F,K`00S v00 2[34[<03[80(P@ <P K .S 0S0( <0R0(0 -LM`Kp&@P0S@PUP踰 -L M `p6P2B@P/P+ PP&, 00S S0L,0 ,0P4*P 0 SP ,K4K @@P {``(K\` -LMp`P(K &@PL( 00S S0B(0 (0# P @d -0LStpPB`. T@! 0PU`pPE@TU E000 L -PQL`p@P gP) 00S.S%_P 00S.S 0.S PP*L P *  P*h;L -p LP G`@CTP@@< T`h6`P@ P00CS0 -@PL @@ 0"@T 00h -Lt P =00D00H00L0(0 P00T00X00 \0 h 0-@PLP  P 0000000 000 0-MLM0P S ANK@D@D @0CP @AP000K0 -LcMXK M`\ , $@P X&KeK @ (K00C0eK S@(K0eKXK@ 0CYP X@`$PPBT0S ZT 0[SOK,]P P0:S 5P 30K F00S8#X VOKTp W1[S S04%40T0VK1`X![T00T0DPZ 0ST P\Vp 7p@P @ TP Wpy<X KQ0P @ P0b @ `P 0f@< p W8t<@Tp PP@P U@ @ X0K@ TWuP*Z00Z0SP IXKAPeP p`P= U`@PX KUPDP@ U$!0@0' EPXPKp @=P000  P , 0,K o,0SpP W0SX[T@V AP`*(KXtx̮t9`so p-LM`?P0:0/mPP JK@D***|* P11;dSPP JK@D*L*$* P11k;Kp訉̉ 0-LMP^<0SY T0ST 0S OK-P.Ph 0S @ .@P@ P TK0ԉ -AML8M0`SZ (K+8pU (@K0 PQP F @PK⤖p?  h0R d0R7 pP4 h0K@P# A K@08@ m0P0S020# p3PP6u A=K0C80C  kp9"PPpK` p-!L0@S00K `PP6 T>P~@P@0P!SMP 8p 'P i0S:P T%p  ?=PPpħ<  0-@PL\\0  0PS@T02 0000 -0L@S4 (p@TP 00  `P@@P<8P0 PP0P4P|P `Ph p-LP@q`P@ q`p -LMpPq`(K0 S00( 2K 9pq0S @P q` K0 00 0 -QLMD H0  Qz H<̠Č8#Č"̌,,H0 @,̠D!d , 0 @ P ` p @0  < 080  4 000 .2 0$20%20&2 0'2(0(200*280)2@0@0#2H0<0@#2P080P#2X040`#2`000p#2h0"2p0,0 #2x00 , @l  D<,  L8  T4 \0   t DH4 d @P`$p,4<5(K8 -QL MPp` Q QiPc  a$ KPZ@ I$00@PP%jP @PF  f008 KP :8 KP0@  80K@ X 80[S70[0SS 70[0S SP @0(KP v(0S K p- `LV@P p 0P*(0 0p000p褊 -L M`Ạ pḀ0@P `4 ĠDT"4!Č'(D*T0K 2KKK