^Юn PPՀPpPP! P ^ԭԭլլP1ݬPЬݭPխP1խP1íխѬ P1 լYԭFլݭЭ~֭ݬݭЭ~֭ݬPխ P Po֭ì PѭPZЬ BլݭЭ~׭ݬXݭЭ~׭ݬPխP׭ѭѭP^ԭլPaPXݬ|Pݭݬݏ4/ ~.ݭݏRݏ?`ЭP^ݬE^լ ЏSP?ԭ*ݬPwPPP֭ѭЬP^լ ЏP:ԭ"ݬPPЭP֭ѭЏP^լԬլ  Ԭ լԬլԬլԬլԬЬAx:P<x%P<xPDxPDmxP@1xP@9?+*$#xPHxPHx|PLxgPL_xTPPx?PPGx,PTxPTcxPXxPXCxP\xP\ݬxP`P~ݬ xPdP~kݬx}PhP~QݬxcPlP~7ݬxIPpP~ݬx/PtP~^ԭѼ1լռ ݼԼ~ݬP$~1Pխ ݬݭSԭռ ݼﳺԼխ.խ~P ݭݼݭ{^Ѭ P1լЏTլЏU1ЬP֬`ЬP֬` ЏPP} ЏPPfP]~PP]~P ЏPPЬ P׬ P1ZP^4l ݏVo< -^ -^PݏpݏW'Pkݏݏq^ݏ;ݏ;ݏR^9d1ݏPѭ<ݭePjRӲݏݏaݏjPmj^ bݏݏ{^ݏݏXݏixP i(^ݏ :ݏO9ݏ^ЬxPLЬP1լPPPЭP@֭ѭ ЏЭP@֭ѭ氭1hЭP@֭ѭ ЏЭP@֭ѭPQzRRQBRQ@J (PQRRQB!Q@,&! R PEE^ЬЬм%P ݏdOݏݏݏݏݏ|ݏvݏݏݏݏݏݏݏݏݏݏݏݏݏݏݏݏݏݏWݏݏ:+&P ݏYݏdݏ*tݏX'ib%o&HmP6NݏݏXP3ݏ5ݏX!6ݏ3ݏX1PݏZ#ݏZ#wP ݏ<v#ݬݏuݏ[:ݏݏݏ`?ݏݏvP ݏ, ݏݏ`tGݬݏݏѬ1P %&6~1ݏݏݏ`g1-U%<.%ݏݏ>ݏݏݏ`P^ݏjPC= ЏP@ݏEP" ЏPݏݏP^ݬePPP` PP ׭խP^D8ݏy{^^^ݏ ݏ 5PTݏ ݏݏ ݏݏ ݏl".yn c0P^P8^qݏ; ݏ+ $ݬ ݬݏ< =ݏV ݏO ݼݏ\ ݏW ݏv ݏ] ݏ ݏw ݏ ݏ ݏ ݏ Џq* ݏzݬPP1Ь֭ԘP]oݬ0PE?ݬݏ  ݬݏzPPP!#Ь P1KݏPEP PPPPyݏ ݏ TЬ Lмլ1ݏ#PLݬ"Pݭݏ ݏ ݏyP BݬrP4ݬ ݏ ݏ ﰾݏ ݏ ݏ ݏ zݬ Pݬݏ O}_4 ,ݬﭮݬݏ  ЏP1] ЏPЏP1۩Poݏ9 ݬ/P[ݬݏC ݏmݬݏ` Џ#nЏP1 ݬݏzռ1Bԭԭݏq ݬP!vpݬݏz 1 PPP1խP!խ P P ݭ߭=ݭݏ ȷPխ@9 ߭ݭ﫶PPPPݭݏ 9x"oiݏ ݏ  NO,ݏ ݏ ̑ݏ ݏ ﵻ1 ݬ&P1ݭݬݏ |cЏQѭЏ1ݭݏݏ 0y/ݏP/ѭ̏ݭݏ+VCNݏLPխ8ݏWݏ%ݭݭAaխ ݭﺨԭЏP1-ЏP1#ռݏyݏtN2a~ݏIݏ+Bݏzݏtd2a~ݏeݏJ aImݏzݏt!֥Pݏ}ݏf˹7aݏzݏtݏݏ~ݏݏ{ݏyݏtRݏyݏt9OЏ4~~ݏy=,``ݏyݏ t-+Pݏݏɸݏݏ﮸ݼݏݏݏݏ{hP^ݬ{-^ԭnݏݏ%SP1&P1vG5ݏ ݏPݏ ݏ 1ݏ絛P戴Pݭݏ:ݏ-ݏyP Џ<ݏSݏ;PݏkݏT2Yݏݏl>,խ0ݏzݏݏݏݏöЏݏݏP^ԭP/P"ݏzPMЭP^q ЏP1?P1]U^Mݏzݏt6Pݏݏݏݏǵݏyݏ tPݏzݏtP ݏd,!ݭݏݏ`խݏݏ @RЭP ^ݬݏլ ЏP1 ЏPݬPխD߭ݭ֩Pݭݏ1ݏﶴխЏݭЏݭݏ=ݏ2}ЭP^Џ>\[P/ݬPPЬPPݭݏN߭߭\ݏVݏݬݭ\ݏ\bŬݏݏiγbݏwﹳ(ݏ$bщPխc>bݏ%\ݏ\٣bb'ЏP1߭ݭݭݏݏݭݏ$b׈ԭ1ݏbPPPP& 1rݏPP1<խ1ݭݏݏ(ݭPݭݏݏTݏݏ9խjaݭݏݏݭݏݏ)ݏPݭݏݏE̱fխ kխ3bȮݭݏkݏSM&ЏP^ݭݏݏljЭP֭P1`b^%PЏP^q@a8T%ݏPݏݏ.%P^ԭЭP ^Џ ЏP1ݬ ݏݏ}ݬݏݏeݬݏݏMЬ 97ЬS% ЏPЏPPݏݏGݏݏ͛PP1ѬѬЬf ݭPݬݏݏ|Ѭtk ^~~ݏyl"Z <ݏyFݏ ݏV V|<ݏCݏ!̮pVݏy{ TV8e /ݏbݏD+VVPPV-  V1ݏ{ݏcCUլ 1 UUݬ ݏݏ|U1EUUUUUUݏzݏt酪PݏݏoUݏݏy Uݬ ݏݏXTݏyݏ ts(P ЏP4ݏݏV P^ ЏP1Ѭ ѬѬݏyݬYT=ѬJTݏyլ+Tݏyݏyݏ tFP ЏPP^iݏݏ 2ݏ ݏݬݏݏ ݬݏ!ݏի ЏP1=Ѭ3Ѭ)ݏFݏ"P1-iPݏkݏGNP1cݏݏl2tJ ݭ6PѬ ~~ݏy ЏЭѬ ѬѬݏyݬѬSRݏyݬ>Ѭ 2RRPP!RլRݏyݬ QQݏyݏ tdP ЏP6Ь0Ь,ݏݏP ^ݬݏݏ￩ݏݏ朗ݏݏP1aլ ЏP1RԭЭЬPyԭ141-1&1111 1 1 1 1 1 1 111ԭ1PxMP(P1zP1iP1YP 1cP1n P1]P<1aPx1v,P1ZP1E1wP1D1hP1NP191KP181<19ݭݏݏݭݏݏխ!ݏݏѧЏP1խЭݏ zݏtP ЏP1]OVO,ݏ zݏtWPݭݏݏKխ.ݏzݭݏݏ!ЏPP ^5Џ(-PݭݏݏѦЭЭP^ݏݏ"HNݭݏ<ݏtGݏ zݏtIP ЏP1,NݭݏZݏ=+ݭݏgݏ[ЭP1ԭ121ЏK1Џn1Џ1Џ1Џ1Џ,1ЏXvЏlЏbЏ` XЏNЏ%DЏK:Џ0Џ&PSY`kvݭݏuݏh%ЭP^Pc1Uݏݏvܤ:uzݏݏ﹤80O(Gݏ6ЏP= ЏPЏP#P?zPʏP^߭ݏfNPAKݭݏݏݭݏݏף}ݏݏＣխխѭЏBݭݏ?zPKݭݏݏ\ݭݏݏDݏݏ)ЭP^uЏn4ݏ)ݏ ЏP5ݏBݏ*￢߭ݏtP^Џ^P^ЏԭԭԭPݭݏ\ݏC9߭ݏwtݭݏݏ]խխѭPPPЏݭݏݏѡ71ݏݏﰡݏݏխUլP|PѭPPPݭݏݏSݭݏݏ;2P%PPPPݭݏݏѭխխPPPխPPPݏݏﬠ^ݬݏ ݏoݏݏ TZF>ݏ>ݏ)]lݏfݏ?ݬۗݬݏwݏgǟլԬﰗ綾^^ݏݏx|mݏ2^SH=^ԭլP1߭ݏfݬPݭݏݏݭݏݏլ ЭP:.ݏݏﵞ խPЭP^> ^ݬݏݏWѬP1ݏݏ5ЏZ[[P[PZQRRQ`[7[1b UOP?zPʏPPZZ'Zݏݏ︝ZЏ[[[P`[Џ[[P ^ ЏP1ݬݏݏYݬݏEЬ1í~ݏ ݏݬݬGPѭݭݏݏ ЭP1խ$ݏ ݏœЏP\ݭݏ.ݏ!­խ ݏd9լЭP׭P19ѬЭPЏP^} ЏP1ݏ*PS*qPխԭݏy)P`P ~p~ݏ<ݏ/ΛݏGݏ=瀞ЏPa߬ P5sݭpݏSݏH^ЏP>ݭPpP ^ЏԭԭԭP ЏP1ݬݏ^ݏTݬ ݏjݏ_լ Ԭ լ <ݏｒPݬ oPݭݏwݏkݏy𣏕P(ݏݏxlUЏP1ԭԭ蚬~ݏݏ<* ЏPЏPP[~ݏݏ1] PJP?zPʏPPZ12Zݏݏ﬙RݏݏZ'.[[ݏݏd1Z/'ݏݏ9ЏZ1խˏZPQPQխ[P[PZQRRQ`[FЬPPʏP PˏPѭPPPݭݏ ݏ律w["խЬPPʏP PˏPP[KխFŏ_PЬQQʏQ QʏQQPPݭݏݏ .pTDLPPZPP48֭ѭ+)լ  ݏݏ}ЏP1ԭխZݏ2ݏ#ﳗ1Wխ1OP[PլլˏZPQPQˏZPQPQ1ݭݏDݏ3Z[ݏMݏEC~ݏ\ݏN([P`P P1[~ݬUPhݏqݏ]іݬݏrｖЏԭ P`֭ѭ[ݬݏrլ b [ݬݏ^[PP[P1M5 ZP^ԭ^ ЏP1լwJo b\P?zPʏPPխЭP PPP1ݏﴍPݬjPݏyﺌP Џ0 ]P?zPʏPPA ѭ¬խԭݭ^ݬݏݏ+լP1Ѭ3Ǐ~ǏPďPPPPѬ PJݬݏݏ̓ݬnPݭݏݏP^rP:^V:PݭݏݏIխPЭP^߭߭siPݭYlPݼݏ^ ~PЏЏP1P1ݏ'ݏݏ(ﶂPԭݏyݏtݭ_~P ЏPaݏzݏtݭ<~P ЏP>ݏyݏtݭ~P ЏPխ ݭhJP^5ݏ<ݏ1ܑݏKݏ=P1ݏXݏLݏgݏYesP1>}PP1ݏuݏhDݏݏv PT888ݏzݏ t|Pݭݏݏ祖ЭP^|PPRݏݏh7!88ݏyݏ t&|^eݏݏ JPi{PPXݏݏ׏ݏdxݏݏﭏݏyݏ t{^߬^ݬݬ܌^ݬPݭݬﲌ^ԭЭP@P ЏP֭ЭP@QaP^ݬݏH^) zPPЏPPݏݏ|P  ^ԭլ\߭APխխPʏP1 Żݏݏ請ЏP1լݏ ݏӍݏPݬbPݭݏݏ ݏyﮄP Џ߭rPSխ PʏP<ݭݏ-ݏ9ߺݏAݏ.ЏP^ЬݏJݏBP^ݬݏSݏKﻌѬP ЬP^ ЏP ЏP^լ ЏP ЏP^ԭuPtPuPsP Џtrq ЏdPK; Џ2ЭP^!PPA0VP `PP^ԭP{ PЭP^^ݬݬzPlЭP^ԭQPխ tPsP yPխ -rP"rP IPЭP^P^ _$  Ё^rPuPjP^ݬݬݏtЬP@+ݏݏ|fݬ PP1iѬݬݏ355P1ѬMP/ݏݏnݏݏP1Џ`P1ݏݬMmP[ЬP[@fЬP@[ݬݏЬP@>ݏyЬP@"^ЬP@PP^ݬݬݏ6լVЬPݠݏݏ ЬPݠݏ*ݏЬPݠݏ;ݏ+݇ݏOݏ<ćѬݬݬݏP漢ݬ7PP1MլѬHЏp<Ѭ ЬP@ݏeݏXZtaP1ݏf߭׀լ1ЬPѠ'ݏh߭︀ݏxݏj߭ݏy߭ݬdkP[ЬP[@}ЬP@rfݏݏ牢3ѬЬP@@M}ݏݏpﴳwЬP@PP^ݬPP1Ѭ? Pԭԭݬ@PEЬP@p(ЬP@`ЬP@siPЬP@]Џѭ!ݭݏݏЏPBխ!ݭݏݏZЏPݏݏ:P^Ѭ7;+P$`PʏPiPЭЭPbЬP@QaЬP@PРQ֠aPЬP@ktfPѭ ЏPPˏPP ^ԭݬ P ЏP1Џ1Э߭ݬ P"ݭݏݏ"ЏOB:PѭP8 ѭ  ѭ ѭ  ЬP֬ `֬Ь P׬ P1qЭP^ЬP@Xݬ ݬw^17P !ݏݏaЏP1 jYݏwPD>ݏݏ P ;ݏ%ݏݏ4ݏ&΂ЏPۯMoP  ݏSݏ5ЏPJݏvݏTyЏP*ﶯy{mPf`PʏP^ݬP ЏPkլPbPYѬ(ݬ{PݬЬP@P~a+ЬP@ݬgP ЏPP^ݬݬZP ЏPUѬ!ݏwЬP@(P~~.ЬP@ݏyvgP ЏPP^ݬ ݬЬP@P~~P Ь PЏP^Ь[[*߬KP~N~PPЏPaKiP`PKYQСR֡PbPPKB~cPK'P  ЏPPP^`bݏݏ{-GP1:2ЏP1c?P~Y}PP%ݏݏϬPBQݏݏݭݏݏxЏP^լѬ  ЏPЬP@PP$^ݬxPѭ ݏݬoxPP1߭ݬ xPխ"ݬݏ~ЏP1iPݏ'ݏwP10]P19Џ(P Xݏ:ݏ0wݭMMݏ;gPP1ݭTݭTݭGMݏE^Pխ2P`Pխ ЭP Э ЭPР ЭЭЭP֭`/Э약ݏTݏKvݭݭvݬݏUݭݭaWW)|ݏkݏXzvP1SݏvݏlZvխLݭ?Lݏwݭ?WP[ЬP[@ܾЬP@Ѿ6`#JݭKݏyݭVP[ЬP[@ЬP@ӢP^ݬݏݏ{uѬ ;ЬP@6hPЬPA;@խPP1ЬP@ݏݏ6uݏݏuRݏݏt ԽaBrPP﷽ ѭ諒ЬP@fXЬPuo@IP^)ݬݏotլP1~ݬPխЭݬݏ-t?'ǡݏݬOP ?ݏU`PʼPݏ︼ݬP0ݏsP1ݬݏosݬ9m P~_PխP1ݭݬQ'٠ݏ ݭaPݏݭP(ͻ̻ݏrݭݏ rݭ`P^PP`PX`ݬlX~ݬݏ Ar>P^P0^ԭԭЏѭѭЏЏЏЬ#ЭP֭ЭQ֭a`ЭP֭PԼ1 íЭѭܭíܭPPЭP֭*`ЭP׭`ݏݏ# VqݏPݭݏH ݏ: -qDP `.'ЭP~~FPѭЭЭP׭PPѭP?ݏݏI p~ݏY ݭiЏ@ ֭ѭ1ռ:ݏݏ_ jpݏu ݭ:iЏЏ^ԭЬݬݏ} pݭݏ  pݬ5P1ԭݬiPݬiP[ݬiP[[~0\P ЏP1ݬݭKiP/ݏ ݭh߭ݬݭݭhЭݭݏ Xoݭݏ BoЏݭݬi[PϜݬݏ o+ݬ!lP隆ݬݏ nԭխ ݭ\ЭP^ԭЬݬݏ nݭݏ nݬP1ԭݬIhPݬ;hP[ݬ.hP[[~ZP ЏP1ݬݭgP/ݏ!ݭ?g߭ݬݭݭ%gЭݭݏ !mݭݏ!mЏЭP^ǏPďPPuPPխǏ\PPЬPԠЬPЏ !d3ݏD~P[ЬP[ЬPݠgP[ЬP[ ЬPԠ ЬPЏ!!ЬPԠЬPЏ"!ЬPԠЬPЏ#! ЬPԠ$ЬPЏ$!(ЬPԠ,ЬPЏ%!0ЬPЏ4ЬPԠ8ЬPЏ&!<ЬPԠ@ЬPԠDЬPԠHЬPЏ'!LЬPԠPЬPЏ(!TЬPԠXЬPЏ)!\ЬP`ЬPЏ*!dЬPԠhЬPЏ-!lЬPԠpЬPЏ.!tЬPxP ^ݬݏ!kЏV!P19ЭPРlݭݏd!ݏW!kѭ Џe!P1ЭPՠ ЭPѠ  Џf!P1ЭPՠ  ЭPѠ  Џg!P1ЭPՠ ЭPѠ Џh!P1ЭPՠ ЭPѠ; Џi!P1нխѭ;ԭݭЭPݠЭPݠЭPݠ ЭP~ݭݏj!ݏcݏ|dPݭݏݏ!jѭf!ЏP ^:!߭ݬtcPݬݏ!@jЏ!P ݭ,^ԭݬݬݏ!jլ$ѬЬP ЬP : ЬP:ݬݬݏ!iЏP1ݬݬݏ!iԭ4P`P]ݬݬݏ!~iЏP1֭ѭݬݬݏ!Vi֭JP`P]PP`P]ݬݬݏ!iЏP1dѭݬݬݏ "hݏ7"ݏ"hݏ9cݏS"ݏ8"h2P Џ5iݬVPP,#QPQ Џ3ݬxVP` ^ԭݬݏ$\ԭЭ..ݬݏ$h\P1P1֬ЬP֬䑼\խ֬PXԭխPJ?֬֬4*ЬЬխЭЭP1l^ ЏYP1PҤݏ% CPKUDP*PѠݏYTЏYP1$CPJT3DP)PѠ7ݏYTЏYPC.DPЏPݏYQTЏYP ^~ݬݏ %Z~ЬP1ݬݏYSP ЏZP1ݬTPԭ#P`/ЭPQa[ ֭ѭЭP[ѭ5PCPݏ\CPխ@ݬݏYpSЭPݠݏZ\S~ݏZRЏZP)ݬݏY0SݬݏZ SЏZP^ ?P&խ ЏPy߭VѭPЭPaEPݏ%PMݏ.ݬݏE%ݏB%ݏ:%9ݏH%lIݏ-P^l>P1ЏP%P 9ݏX% @Pխ2ZPAPխ ЭP Э ЭPР ЭЭЭP֭`/Эլݏ^%ݭݭ8ݬݏa%ݭݭ88wѭ ЏPiOPOP߭UPP ѭݭOݭOխPPP ^ kݬPPPwխPnݏCPݭݭݬ~PPPPPݭEԭЭP$*?PЬP֬`P$^լP1P1߭ݬOPݭݬݏd%Vѭ%ݏ{%ݏo%dVP6<~ݏ%ݏ|%GVvQ[ZL9 D uu^1bt^ tPPtut0t'ttP PPtutvjub[uYt*"`t TtuOĞ﬜tMu u [[PˏP[hqtJ}<ݏPխsNQss[s s[G t?7Pխ{s OfsZssѭ ѭѭP[PʏP@s t@[PP[ѭ  ѭssPѭPsrѭrsrѭrws jsYW Ws򉕭 r񉕭or+s[mr-drYWVfVVsPPЭXZ[sYPP1{sYYiimsYPPbЏ(VX VЭP֭f'iݏ(ݏ"*E(sX~ݏ?*ݏ2*E sXhh[hPB1rYhihrݏ@*NEhP^ss}sݏ]*ݏO*Eqݏv*ݏ^*D7rp!r#syrqrpppWrЏp&ppЏYprrrrqsrrrrhqrr ooooUPoo4=boUorosoqyPխЭPi{Pݭݏ*ݏw*CխЭP9oyPխЭPҙP^}pKq^߭ݯݭݏ*1/mq Џ*~Џ*~ݏ*/pP@(ݏ*.ݏ*ݏ*.pojoaoݬ@P#^^]o;o5o,o&o}p'o!oooooo on Џnnݏ*ݏ*Ammmmm{mmmym^MoTo6#ݏ-P  ݏ*)' oݏ+ݏ*XA,pݏ+AApݏ+*Anno oooЏ+o Џ+oo{:nnЏ%+nЏ`mXn^umomfm-n ]om mam!Pԭݭݏ2+ݏ&+=@ЭP[Џ3+gЏQ+]Џ[+SЏn+IݏP Џ+PЏ+PP"Џ+Pdmݏ+ݏ+?ݏݏ+?ѭG$n ݭ _ݭ "8ݭݭ+mzP1mm m m.7HmUzݏS|߭ƫݭݏ++Vm Џ+~Џ+~ݏ+*ݏ,ݏ+*ݏݏ,>P^kݏ,ݏ ,h>kP@mݭݏ ,ݏ,@>խ4kPlJluPݭݏ/,ݏ!,>Pݭݭ7P,k~Q^kݭݏ9,ݏ0,=ѭ ݭx:Z ^qqj.aݏajݏ:,j6j~&j{Pݭmj6`j5KjݏA,<kݏH,<jݏV,(k2|k*rkݏ`,<]ki6Џ{,Eki,6P iPj{߭iݭݏ|,<խݏ,ݏh5*ݏ,ݏh5ݭݏhx5ݏh,ie5jݏhi*iݏh55ݏhݏ,z;ݏhPݭݏ,ݏ,Q;ݏhPPPP]oWoݏhݏ,;ݏ,ݏhg4PEioխ1yhݏhݏ,:hP1@ݏ,ݏ,:խ9Џ,ݏ&-ݏ-&nn"iP1~ݏhݏ'-&11խ9Џ5-ݏu-ݏU-U&RnLnhP1#ݏhݏhnݏv-&ݏhݏ-9mݏ-91I`hShݏ-ݏ-9ݏ-ݏ-%1ݏhݏh91ݏ-ݏ-C9խ7Џ-ݏ.ݏ-L%ImCmg1ݏhݏ. %1ݏ8.ݏ*.8խ4Џ9.ݏhݏb.$llQg1fݏ.ݏ}.8P .+ݏhݏ.S8wlݏ.<8Vf5^l-Rl%Jl07lݬ1#ݏh0ݏhݬ1ft>flݏhݏ.7ݏhPDݏ.ݏ.7ݏhݏ.#Џ.ￋfPuݏhݏx0ݬݏ/97dMGFxЏiP7ecch+P ^dݬݏ!/6ueݏ:/ݏ-/6ﱩ#MekݏK/ݏ;/6̪#ê ﺪ?d^ݏY/ݏL/=6 cdP14^dMdݏf/ݏZ/ 6dݏs/ݏg/5Yݏt/5}dYDPPPcd]dYdPPP泌_b5dݏ/ݏ/p5dd~~ғPխObA;aݬݬr#cЬPՠH1ЬPРLЭP֭`MYݏݭPխͧݏݏ/ ݭݏ/ ݏkPdݏݭPխmݏݏ/z ݭݏ/f ݏP խݭݏ/ݏ/4WЭP^bbbb{bc^9BMPP1լ1wbHob@gbabݏ/r3ݏFb-Џ/0b1aݏ/ݏ/23a]ݏﵷݏ/3 Џ/ Џ/ݏk-ݏ`,aݏ0ݏ/2`(_ܷ_,_ݏݏ0Z2ݏ 0E2ݏPP18```PP1 ݏpݏ01Џp:_U_լ ЏXPЏFPP~Dլ1_Cݏ^ݏF0**ݏ0o]*ЏݏP"ݏݏPݏ0( ݏ%0@_8_ݏ70ݏ)0ݏD0ݏ802ݏp]ݏX1)ݏpݏE0+]%]$)][UTЏ}PK^E^ݏ_0ݏS0/P ^ݏs0ݏ`0/ݏ{0ݏt0/7]ݏ0ݏ|0/]\ ЏP1P1gݏ0ݏ0L/g1eݭݏ0ݏ0)/HPd\ݏ0ݏ0/խP1*]]:Z' ]ݏ0ݏ0.P1ЏP1%Zݏ0ݏ0.ZPխ=[\ ЏP1ݏ0ݏ0C.Pp[ݭ|[ݏD_APݭݏ1ݏ0.խ ЏP#YPѭPP׭խ1P^AլC>ݬZݏZ@[ݏ.1ݏ1KZݏ/1ZݏZ@\P^ZdP$xZݏH1ݏ01-ЏP ݬ8^FPխ-Zݏ\1ݏI1,Zݏj1ݏ]1,ݬ^$FP ЏPBݏk1YݏB?[[[[ZQ\P ^W^ ~fd WPPTdW= PP;d WPP,d@XPPd XPP dXdWPcY&WWWPWݏx1ݏl1h+bWݏ1ݏy1M+W Nc DWycsc更WPP ЏBP0VPPEcW-W V+cWVVc c$W WPPV VQQQPV VQQQPV VQQQPV VQQQP PPbV UPP PPwbU^ UUǏ_UPPP PPEbǏ_wUPď_PPhUP PP b0b_b_ b_bGXPP P XQQQPWQQQP PPaWMJVݭ&#Pխ0ЭP֭ QQ ЭP֭ЭQ֭a ЭP֭! ЭP֭0 ЭP #W3ݏ ݏ1(ݏ "Pݏ  ݏ ݏG"Џ P^ݬݏ1{(׬KЬPP PʏPЏPPPSSѭSЭSѭ  ЏPPЭPPSSSS SSA8KЬPP PʏPSPPխ SPЭPPSSuS9PgS}S?TJ;ЬPP PˏPWSJЬP@QQTS-S.ԭS~6P[ЭP[֭ѭRWJPPЬPP PʏP PPSS S SJ ЬPP#PPѭ ѭ?ѭ_ѭЭP#PPBSI ЬPPPPnRhRY VR;RR  IR?@R_3R !RRRݏ1ݏ1%Rݏ1ݏ1%Qݏ1ݏ1%Qݏ1ݏ1%QPhQjFS| {&xQ&mQAeQpQ hQYPPPGQ GQ6Q PQQЏNQRH.ЬPB ЬPP0PѭѭЭPP H _ЬP PHQYgQP) ?_PP{PPPPPP}PPPP kG 1ЬP P PˏPݭݏ1ݏ1#7P 1PPPP%PO OPPPOO OPPPOO OPPPOOݏ1ݏ1R#Oݏ1ݏ17#5Oݏ2ݏ1#O(uOoO NPPP[O-Oݏ2ݏ2"Oݏ2ݏ2"Oݏ)2ݏ2" ֭P`P PʏPP Eݭݏ12ݏ*2W"Nݏ>2ݏ22<"vN1PrEP1PP`P PʏPď_PQQaQ QʏQQPݭݏK2ݏ?2!RMѭЭPЭPP,Mѭ@# Џ@#PЭPP MM  ЏPLLLOL ЏLLݏb2ݏL26!Lݏq2ݏc2!LL3PLCM1N.K ЏKKݏ2ݏ2PBPPP`P PˏP︢PBP1 PP`P PˏPխ1ѭ PPbBPvݭP P~ݏKTݏNPKK3KPݭݏ2 KL AvP^ԭLݏ2ݏ2UЏ^JK,K0KݏKP1P1L8ݏ3ݏ2' ݏ"3ݏ3ЏP1OЏ12uK1^Kݏ03ݏ#3CKPݏIPI`ݏ[]Jݏݏl3ԭ'Jݏ3ݏ3KiݏKPXINݏЭP@&Hݏݏݭݏ3֭5Iݏݏݏ3eP1ݏ3zP1Pݭݏ3ݏ3{ѭ#֨ݏ3U1խ I H1Џ1խ ЏP1ЏH(Hݏ3ݏ3>ЭP1bHOݏ@Pݭݏݏ3խ \H1ݏݏ. ggݏ} PgwgggggPg}P ЏP^ԭP1ݬ| g|gsgݏ5ݏ} Fgݏ}q P6gP(g">>ݏ5ݏp >Џ4{>^P PʏPPP`ݭݏ5/ݭYP_Pݭݏ5ݭļ.=g+ݭcݭݏ5P,ݭݏ5~ݭݏ5P^լP1P1ЏpЭP֭ЬQ֬a`ЭP֭ЬQ֬a`ݏpݏ6ݏpTPIݏpݏ6{<u<d<====ݏpݏ*6P^ЬP֬`P PˏPЭP֭`ݬ_Pݭݬݏ>6.ݭݏE6ЭP1ݭ!PV:P1ݭ P{:Pp:P1ݭPm:Pb:P1ݭP/:P$:P1~ݭP):P:P1`ݭP9P9P1BݭtP9P9P1$ݭVP9P9P1ݭ8P9P9P1ݭPO9P1ݭPX;P1ݭP0;P1ݭPխ<;ѭ0;Э:P1nݭP9;P1WݭP9P1@ݭrP9P1)ݭ[Px9P1ݭDPe9P1ݭ-PR9P1ݭPѭխЭ7P1B 7P1P1ݭPG7P<7:7@# Џ@#(77^ Џ^ 7B76GP6P16ݭhPѭ'ѭ7ݭ$P6P1P1ݭ$Pѭѭ_Э6P1P1ݭPխP1Э6P1ݭPխѭ ѭ P1oЭ/66F~66KP5P1:P15P:Qo#QAQo#QXo.E7l1^6ЬP1ݬݏW6ݏL6ݬݏe6ݏX6ݬ ݏt6ݏf6PĬPP  Ǭ PPݬݏ6ݏu6ЬP^ԭ5ݏ6ݏ6]51 41Џݏݏ6(4ݭPݏ6ݭhPݏ6ݭNPݭݏ6ݏ6խ 5(5^A Aŏ`2@ŏP2@ŏ@2@ԭ#ЭPЏ@>ЭPЏ@?֭ѭ@2&k ^ԭԭ1 k1P1|1 ЏP1j ЏP1^11Nլ1ЬP@,>լP?P@>լP?P@>ѭ2ѭ(ííݭݏQ8ݏH8\=1ݏj8ݏR8?ݬݏ8ݏk8'ЏP11ЬP@s=լP?P@[=ЬP@N>ѭ2ѭ(ííݭݏ8ݏ8!ݏ8ݏ8ЏP1ѭ Џďѭ ЏďЭ>>P>PЭ>ԭ1>>>>Pq>PPq>íPíQQP^>PI>PPM>K>ݏ8ݏ80> ЏM">>>P>PP>>ݏ8ݏ8x=ݏ8ݏ8]=P=PƏPP7h. 'hPPh.@ hPPPgg. .g.g. .g%..PgP }.ggݏ8ݏ8P$^ԭܚJ1~ݏ8ݏ8`1ݏ8ݏ8E/ݏ8ݏ8*000gЭP101-1 0P@0/ݏ8ݏ8/P@/ݏ 9ݏ8ѭPEuPѠ/i/$$ݏ-9ݏ 9\}APuPР %%Py$PtPР1v$Pݭ$ݏ.9#ݭݏH9ݏ999$Pѭeѭz+ݏI9@ ݏY9 .AЏE1ѭ ЏqP1MխIݏ9ݏi9b@ݏ9ݏ9-ЏE1Q@ѭE.ݏ9ݏ91ѭQ1o+dd|+-PǏ@PQď@QQPQQݭݏ9ݏ9ԭ-1ݭݏ9ݏ9ЭP@-cݭݏ9ݏ9UЭP@v.խPrPՠ(ݭݏ:ݏ9ݭ&PǏ@PQď@QQPQQѭ1KխW,ݏ:ݏ:,P+ݏ:6ݏ):,7ЏE11[ѭT1jc*,ݏW:ݏ4:Qk,ݏt:ݏX:6_P1B,PF1,ݏ:ݏu:ݏ:ݏ:K+ЏE1P 1!+9) m,z ݏ:ݏ:1 ݏ:ݏ:m P@+ݭݏ;ݏ:EխF ݏ,;ݏ;%ݏ-;ݏM;t*ЏE1y (+0 9Pݭݏ;ݏm;ѭ b91xխ 97ݏ;ݏ;u6Z6ݏ;ݏ;Qk* P+ݏ;ݏ;)ЏE1 1,*ݏ;ݏ;*1ݭݏ;ݏ;ЭP@)_ݭݏ;ݏ;ЭP@*խP?oPՠ$ݭWݭݏ;ݏ;c)PǏ@PQď@QQPQQѭ1L1 խ1!&h>)P@5X.)P@5)PǏ@PQď@QQPQQ)ЏY(~ݏ<ݏ;1; Pݭpݏ<#ݭݏ3<ݏ$<Pѭeѭz+ݏ4<ݏD<'ЏE1 ѭ ЏqP1 ѭ1ݏT<%ݏp<ݏh<(ݏx<ݏq<'ݏ<ݏy<9ݏ< '@ЏE1 9ѭE:(ݏ<ݏ<e1ѭQ=%@^f'PխЏE&11ѭT1$]'ݏ<ݏ<'ݏ<ݏ<&oP7Q$ݏ=ݏ<&#ЏEЭP1S&P@'ѭ[PlPѠDEPkP QQ####ݏ0=ݏ=1ԭ#&?4P.ݏ@=ݏ1=%ݏR=ݏA=ݭݏe=ݏS=ѭY1kխ13#n\P@1P@&ݭݏt=ݏf=Dѭ1PjPРݭݏ=ݏu=ѭD1w"NM&j"AM;Mݏ=ݏ=%cPojPݠݏ=ݏ=PKjPݠ ݏ=ݏ=~("ݏ=ݏ=cP jPՠbPiP QQLHPiP {LuL! !cL]Lݏ=ݏ="$6!ݏ=ݏ=#Lݏ=ݏ=0$HL!;K! 2Z*x!  ݏ=ݏ=e1 !DKP P3 KPPP  ݏ >ݏ=u PP QPQQ QX Oh P9KP>T S 1#KF PPP7 1 ݏ>ݏ>  &  ݏ/>ݏ>mG #&0l.zM"NE"P@.6"PǏ@PQď@QQPQQ""ݏO>ݏ0>1\ݏd>ݏP>1ѭhS_Xݏ>ݏe>/!%PխЏE 11'ݏ>ݏ>6x/1ѭN1nXUݏ>ݏ>:P@"ѭ[PfPѠDEPqfP QQ*$ݏ>ݏ>.խ1ݏ>ݏ>WP@u!խѭ%PePѠ @ PUPխЏEWx1d1'PǏ@PQď@QQPQ Q1ULݏ>ݏ>:PխЏE11<ݏ?ݏ>K?PPPխ&wS jI  1ЭG1խE5ݏ-?ݏ?ЏEݏ.?Sݏ@?T-1ݭݏn?ݏS?1Wݏ?ݏo?a:Mݭݏ?ݏ?BЭP ^[ [PPPo[PˏPZP387PRZPPPPF87PPP8ZPPP0ZPPP(Pe^ݬ ݏ?ݏ?~ݏ?ݏ?fѬ  ЏP1BPЬQQQPЬQQQPЬQQQPӏPP1PЬQQQQQPQЬPPPPPQPЬQQQQQPQʏQQ ЏmP1ЬPЬPЬPP87?ЬPQ87-ЬPQ87ЬPQ87 ЏePVP87?ЬPQ87-ЬPQ87ЬPQ87 ЏoP ЏP^ݬݏ?ݏ?ݬݏ?ݏ?լЬP19ݏ?ݏ?.ݏ?ݏ?FP/)1R խ1Ŭ PPݭݏ?ݏ?ѭ@ǭ ѭѭЭݬݏ @ݏ?ЬP ^ݬݏ@ݏ@ ݏ@ݬ ݏ,@ݏ"@pѬPPPQ PPP^PPPPխQQQPYYݏ5@ݏ-@ ЬP@-ݭݏB@ݏ6@խݬݏf@ݏC@2Pq_PYPa_PЬPP_P[[P[YP`[[[P[YP QQ`[P[YP`Q խmǏ_YP `[P[YP QQ`[P[YPǏ_Qď_QQQ QQ`KiY~ PPX[P[YPX`YP"QQ`խ ЬP֬`Ki[Ь P׬ P [KiP1Y~. PPX[P[YPX`1Y~DP[P[YPRRQQ QQ`[P[YPQ QQ`1Y~DP[P[YPˏQ QRRQ QQ`[P[YPRRQQ QQ`[P[YPQ QQ`QY~P[P[YPRRQQ!QQ`[P[YPQ!QQ` PK[P[YP'`KiYݬݏsPj[PYPZ jP87jZZYs[PYPZjZZY\[PYPZjP87jZZY=[PYPZjZZY&Pe [TݏKN#UPXլP?PX@!TPXЬPX@![ѭP[P yYJPfe> YX>ݭݏz@ݏg@խЭPq!{%ݏ@ݏ{@ݬYݏ@Yݬ~)P ^Ь[["PZˏ?ZPPPZPˏPZZP^Ь[ ЏPЏPPYZkPYQQPPZ[kˏZP^Ь[լ ЏPЏPPXY;kPXQQPPYZˏZPPPˏZQAJL@LQYPPQY[kˏYP^ݏ@ݏ@Hbݏ@ݏ@-rPǏ@PQď@QQPQQݭhPխ!ݭݏ@ݏ@ЏP'Эݏ@ݏ@P^ݏ@^ݬݬݏ@rЬP@ݭݏAݏ@MݬwݬPݬݏAݏAݬݬPݬݏY8ݏ#AݏAݬݏ,Aݏ$AѬJѭ ݭѭ ݭPǏ@PQď@QQPQQP^ݏ-Aݬ^ݬݏ.A7ݬN^լѬ?ݬݏDAݏ3AP1ݬݏJAݏEAЬP@7ݬ&Pݬݏ^AݏKAPNЬP@P>WPРQ֠Q ЏPݏ_AݬݏNP^ݬݏkAݏ`A/Cݬ PЏխ ЬP@)խխ11ѭլ{?rjݏݏfPݏYݏlAݬ#Э_Э[ݏ|AݬݏY ݏ}A%P1ݬݏAݏA ݭݏAݏAP1zݭݏAݏAPUPРQ֠QX ݏAKЏP1)PFUPݠݏAݏAyPUPѠ G:ݬ* ݏA%PTPРP1P1MP[ЬP[@gPTPݠ PTPݠRCPݭݏAݏAt ݏA %]PNTPݠݬݏSP/TPРP^ݬY  ݏEzP >>Эec \cSЭP^ݬٌP ЏP!6  ~P^yP ЏP[լ!  ݏH1  լ ЏJPЏRPP~nP^ /ЏEE~ݏBݏB1 1D1DÏDPP^fԭDDDݏP~ݏݏBtnDխPSѭPЏP?KD3CD+;DÏ0DPP^ DDP^PcD CCC7CC'CCݏ5Bݏ#BP CCP^ЏЬլP1ݬ?PѭP1ЭP֭` P1ЭP֭`P PˏPխP1ЭP֭` PwЭP֭`S IPZPѭPPKPPP PˏP[~[[PPSPP^ ݏMBݏ6BxP ЏzP1 @Pݭݏ\BݏNB@խ ЏP1  POP`Џ82)  PPP - ~~@P[OP~[T@PZ? v5 g& Z1ZݏpBݏ]BPݭZ\ ݏBݏqB", ݏBݏB ZP1`  ZP1R ЏP1H ݏBݏTvݏBݏTYݏBݏݏr F >ЏTP1 ZZ>Z/[[X[P[P`P PˏPZ1XZZ@# ЏQP1| ZP`YZP` YPˏPWX~WPDݭݏBݏݏr% ݏB%^ЏQP1 ZZPY`ZPKP`P PʏPď_PZQ,QaQ QʏQQPMPZrZ[ZݏBݏB*ݭ`ݏBݏݏroݏBG%ЏQP1MZPP"Z[P[P`P PˏPݭݏr ?_ݏCݏCtݭݏCݏrݏ,C%ЏQP1[P[P`ѭhKѭNAݭݏKCݏ@Cݭ"ݏLC#5ЏeP1*ѭI ѭSPPCѭN1IXP`P PʏPPgPíPPHݏfCݏ[C7ݭݏtCݏgCZ[[[UZPJPZDZݏCݏuCݭݏCݏr$ЏQP1YޭPYPYZQaQa`YYޭPYP`FZP`ѭ$jݏCݏCTЭP1P PˏPWX~WP1X~ݏCP PˏP~ݏCݏCX~wPݏCݏCݭݏCݏݏr ݏC%BЏQP11P PʏPxPPQ QʏQQPYX~YP1ѭELZPZP`ZP`P PˏPWX~WP1\ZZP`X~ݏCYݏDݏDXy~PݏDݏDݭݏDݏݏrݏ+D%ЏQP11P PʏPx PPQ QʏQxQQQPQ QʏQQPX~ ѭP1ѭE]ZPZP`ZPZP`ZP`P PˏPWXq~AWP1ZXZP`XK~ݏ:DwP PˏP~ݏTDݏHDSX ~^Pݏ_DݏUD'ݭ]ݏ`DݏݏrlݏpDD%ЏQP1J1DP PʏPPxPPQ QʏQQQPYXu~}YP1ѭELZPZPP`EZP`P PˏPWX+~WP1ZZP`YݏDݏzD4ݭj ݏDݏݏryݏDQ%ЏQP1WRݭ$ ݏDݏݏr3ݏD %lЏQP1PY)WݏDݏDP@YYRݏDݏDHݏDݏrYf PDP֠=PWOPW@b @PЭ@PDP$PDPЭPvDPݭ~WЭP^1 լ*<A P.P ~ݏEݏE(PݏEݏE^J3:+6#Q^ݏEݏE ^ݬݏFݏF?ݬݏFݏF'ѬP ѬP ЏP1A#ݏ`PA ݏFԭPAPԠ֭ѭ sA#ݏP]A ݏFFԭP>APԠ֭ѭ /d~͹P ЏP1,ݏQP ЏP1v@@@P(PP(Pݭݏ GݏFݭݏGݏ Gѭݏ+GݏGЏ>ݭݏIGݏ,Gmx~SPѭ ЏP1ݭ喝P@ݭݏYGݏJGPQQPPPխ ЏPi????ݏkGݏZGíPP~?z?i?k?ݏ}GݏlGP^ݬݏGݏ~GgݬݏGݏGO ݏGݏG8Ѭ Ѭ ЏPx PѬP ЏPdǬЬ ԭFPPЭЭPЭЭPԠ ЭP ЭPЏЭPԠ֭ѭЭP^G>I>K>ݬPݭݏGݏG_ЭPrݭݏGݏGAԭЭPЏ@XЭP@֭ѭ@ԭЭP@֭ѭ Ь/ЭP^M===ݬ1PݭݏGݏGЭPgݭݏHݏG}ԭЭPЏ@֭ѭ@ԭЭP@֭ѭ ЬЭP^ݬݏ HݏH ѬѬ  ЏPXݬDP ЏPAݬP ЏP*Ь`P^լѬ?"ݬݏHݏ HpЏP1Gݬݏ+HݏHNݏ=Hݏ,H3i ЏP1W ЏP1ԭ1ЭP@1ЭP@#P;P`QaP;PЬЬPЭ@ЬP@)PV;PԠ PG;P P7;PԠP(;P` J  ЬP֭ѭ1%dЏP^ݏNHݏ>Hݏ^HݏOH:ݏnHݏ_Hh:ݏ~HݏoH ЏP1 ЏP1ԭ{ЭP@kЭP@P:P`QaݏHݏH3I ЭP7֭ѭ1xݭݏHݏHPЏP^ݬݏHݏHլѬ? ЏP1ЬP@ѭ<ѭ2ЬPЏ@ЭP@8 H )ЬP@dݏHݏH#ЏPXP8P`QaP8PЏP8PԠ P8P P8PԠP^ݬݏHݏHլ Ѭ2"ݬݏHݏHxЏP1P8PРݭݏHݏHEѭѭ@ЭPЏ@MЬP@z;ЬP@m{TGfݏ IݏHP7PЏPr7PԠ Pc7P PS7PԠP^ݬݏIݏ IoЬP@ݭݏ$IݏIJѭ&ݭvPݭݏ7Iݏ%I^ݬݏFIݏ8IݬݏTIݏGIݬ ݏbIݏUIլѬ? լѬ? ЏP1ѬP1 ѭ@Ѭ ѬP1ì ѭѬ ѬPzѭ?6@ѬѬPZѬ ѬPGЏP>խ@ѬѬPѬ ѬP ЏP^P1ݏcI?Pխ P1ݏqI?Pխ P1ԭ1NP5PݠP5PݠP5PݠP4Pݠ P4PݠP4P`ЭP@ݭݏIݏ  ܹݏ >P P1P4PՠrPv4PݠPխ>ѭH ЏI~ЏI~P=4PݠݏIݏ RݏIݏ =ݏIݏ (ݏ =P gPP֭ѭ15KݏIݏ ܸݏ =P PP^P1ݏ J=P P1ݏJ=Pխ P1_ԭ1 P(3PݠP3PݠP 3PݠP2Pݠ P2PݠP2P`ЭP@{ݭݏTJݏ  ݏ XP ЏP1> p!r!o!a!ݏId_P U!ZyP1>$! !P1>xXP ЏP1l>g ЏR[v 1A>;XP ЏP1/>    ݏI^P  ZP1=~  v P1=WP ЏP1=S ЏS[j S 1=WP ЏP1=$ C ݏI#^P  Z8P1S= P1@=7WP ЏP1+=&ЏT[5 1=VP ЏP1<KݏI]P yZP1 P16s kP16PP ЏP16HЏ\_ H%3|!1i6 1S6ZlDiP'4R1,6QIݏ\ PP ЏP15Џ\ p:P\P15L DP15OP ЏP15!Џ\8 !1`5;r7jݏ\P195 P1&5OP ЏP15 Џ\ 1 `{ Ojݏ\P14= 5P14NP ЏP14Џ\) 11 z  iݏ\P1!4 P14NP ЏP13Џ\ w8P\P13H @P13MP ЏP13Џ\4 l 1U30Q,Iݏ\ 2MP ЏP1&3!Џ\0 p8P\P12u mP12LP ЏP12JЏ\a JA12,ݏ}^@q?h?1Z[SDIIݏ\LP ЏP12Џ]﬿ 7ݿnټPü \gݏ]msP11 P1{1rKP ЏP1f1aЏ!]p  1;1RJݏ"]KP ЏP1 1Џ1]ﰾ 1l︾ 3{茶 "jݏ2]P108 0P10JP ЏP10{ ЏG]$ 1[ݏI*>==+ݏH]üP3-PgݏI]冷諾P1/U MP1/IP ЏP1/*Џa]什A *1r/I ︽z8 什iݏb]P19/ P1&/IP ЏP1/ Џp]ﵼ G2ﴼCQ屮P&QP1.1.ݏq]ekP1. P1s.jHP ЏP1^.YЏ]h 13.ѭ%ѭ9 ݏ]P1. P1-GP ЏP1-uЏ] u1-ה1WԭIP=PP PˏPխ1ѭ ԭޭPPQa`֭ѭޭPP`1ЭP֭`P PˏPխ1ѭ ԭޭPPQa`֭ѭޭPP`KЭP֭`P PˏPխ0ѭ *ԭޭPPQa`֭ѭޭPP`߭ݏ]Ë߭ݏ]﯋߭ݏ]D0&ݏ]wݏ] ݏ]1ָ9Ҹ1߭øP߭ﳸPﭸ#߭[P&hݏ]vݏ^h!߭ݏ^vݏ^E ݏ+^6?EP ЏP13+. Џ=^=׸ 1+߸ >zθ -iݏ>^ﮩﴸP1*_  W P1*DP ЏP1*4 ЏQ^ﱸK 4 z~{yP ݏR^28P1S*  P1@*7DP ЏP1+*& Џi^5Ϸ 1*׷ 6{Ʒ %jݏj^令﬷P1)W  O P1)CP ЏP1), Џ}^勺C , 1P5P ?)P1D)  P11)(CP ЏP1) Џ~^& 1(ȶ 3{ﷶ "jݏ^P1(H  @ P1(BP ЏP1( Џ^4  1C< 1( ߭ߴ~ ݭʹ~ɀPgݏ^P1(  P1'AP ЏP1'Եf Џ^} f `  1G~rP @ gݏ^QWP1r'  P1_'VAP ЏP1J'E Џ^T 1' ]{ Ljݏ^ť˴P1&v  n P1&@P ЏP1&ﹴK Џ^ȴb K 1Cj ɴ1V ﵴ߭ ~= ݭ~~Pgݏ^P1/& P1&@P ЏP1&Џ^﫳  1u~ tP ngݏ^P1%0 (P1%?P ЏP1x%sЏ^ 1M%$ z iݏ^P1% P1%>P ЏP1$yЏ _ yPݏ _|P1$1$w zf iݏ _FLP1g$ P1T$K>P ЏP1?$:Џ_I Rݏ_{ހݏ'_ݏ_;1#1#tiP ]gݏ(_ntP1# P1|#s=P ЏP1g#bЏ8_q  1<# { jݏ9_P1# P1" 5:P ЏP1) $Џ_3ͭ 1խ \{ĭ Kjݏ_爛節P1U MP19P ЏP1*Џ_吝A *1~(pP  ݏ_$P1? P1,#9P ЏP1Џ_!ﻬ 1ì R{ﲬ Ajݏ_P1C ;P18P ЏP1Џ_/ 1I7 1# ߭ڪ~ ݭȪ~vPgݏ_ۜP1 P17P ЏP1ϫaЏ_ޫx a[ 1S<~cP 5gݏ_FLP1g P1TK7P ЏP1?:Џ_I 1 v{ڪ ejݏ_ﺛP1k cP16P ЏP1ﮪ@Џ `ｪW @1v+P>> > PPP>>1& { tjݏ`P1 P15P ЏP1{Џ` {1*>ݏ`kH~yrkP== 0gݏ`AGP1b P1OF5P ЏP1:5Џ0`Dި 1 y{ը hjݏ1`ﵙﻨP1f ^P14P ЏP1難;ЏE`︨R ;1%~ZOjP gݏF`)/P1J P17.4P ЏP1"Џ[`,Ƨ 1PQ1{︧ W{裏 Fjݏ\`P18 0P13P ЏP1{ Џr`$ 1ЏQإArPǥPﻥP\ﬥ쑽\֭1K1ݭqPխ1PP`)#kcP\WPf;IP\=Pv1P(&P)`Pb P\PvP(P)`ۤPS ʤP$G ﶤPmЏЏQ߭߭ݭ6Pyխ Џs`~Џ`~P1M EP11P ЏP1"Џ`9 "1ݏQ#Pj8"P1= P1*!1P ЏP1Џ`﹤ 1ݏQ\P gݏ`P1I AP10P ЏP1Џ`5 1S1D3 Τ{" ､jݏ`P1# P10P ЏP1Џ` 1sPP PˏPXP`KPP~?~kaPݏ`R OP1j P1WN/P ЏP1B=Џ`L gݏ`P1 P1.P ЏP1ԢfЏ`} f1 zt iݏ`TZP1u P1bY.P ЏP1MHЏ`W Gn61PbT6ﻡP11ݏa李P1R JP1-P ЏP1'Џa嵐> '1oЏQݏ0O0!B: ݏas=ݏ﫻DΠP1y qP1,P ЏP1＠NЏaˠe N1-ݏ@4P}G \j:P1U P1B9,P ЏP1-(Џ a7џ 1ݏ'ʌݏ ﳜاPgݏ!aP14 ,P1+P ЏP1|w Џ3a  1Jъݏl;Pgݏ4aP1 P1*P ЏP1ڞlЏFa l*ЏQ53).?1ݏaPT)EגlP5h15(ݏGa1ЏIaZ*<&&PJ2ݏP.2ݏP2ݏݏOP111 Џ0~Џ~qRPgݏYa!'P1B P1/&)P ЏP1Џla$ﾜ gu揄ﰜP1[ SP1(P ЏP10ЏmaﭜG 01x3P؛9//ݏPݭݏݏnajmP1 P1'P ЏP1 Џa 1 ﳛﳛݏa1ݏa1 Џ0~Џ~}^Pݏa-O~~P18  P1% 'P ЏP1  Џaﴚ t1 ЏajĚ //|WZߚ<ۚۚFP.ݏｚ6P.ݏ\P.ݏݏP..ݏݏ4Pi︿P1  P1 %P ЏP1 sЏa sJc1 ݏݏ3P--P1ݏaOUP1p  P1] T%P ЏP1H CЏaR 1ݏaP1  P1 $P ЏP1 ٘kЏa k1ݏa b{P1 & P1 z$P ЏP1n iЏax 1,iݏa P1$  P1 $P ЏP1 Џb #E ݏbKdPbbb1Q1 1@﷔ﶔﰔPPP1wݏb ݏ'beP1  P1 #P ЏP1ЏJb 1`Z74P++/>ﮔZ%/01 ЏKbPЏabPP**!'P1B P1/&"P ЏP1Џqb$ﾕ 1])1S)1I)1t׊ݏŊϓE|fk 0E,eA1{^淚懶|sx|^Eݏscݏ]c^n&ﮌݏtc iW1Џ︌~߭ݏXBP7ݏXݏck^ݏc W^1'ѭЭՌόݏXݏc"^ﴌ PЏPPﰋﶋݭ0Pݏc V1Z1s!xﰋP`PxPdPPխ11Џ͌Џ͈̈́ݏxݭ͐-Vݏc͐hV ͌͐VP̈́͌>͐P̈́Q̈́QP͌`͈͐P̈́Q̈́QP͈`͐P̈́P`̈́͐@ҊЏc͐ݏcP1=jx1$ݏ?dݏ0dm\ݏMdݏ@dR\PwݏtdݏNd+\ｊ&ݏud<ݏdݏXݏd ݏCP_U1Fﶔvv*ݏdݏdݏd1Bs*ݏ emݏEe`ݏFeS1g(rhj cOݏ^eݏe‰r︉j ﮉh Џe~Џe~ =ݏeݏeZ%*"ݏezݏemݏݏfRĈ^רּ  ( ݏf|yЏP18ݏ%fݏfY d,ݏ:fݏ&fYPPPݏOfݏ;fqYPPPﾇ︆}ݏ }ЏPfЏQfO@Pﴆʇլ~GPɄￄjP梅P ЏP^ӬPP@^ԭԭԭԭݬ aRPլ1Ѭ1լԬլЏfլЏfЬx~DP1ԭoЭP@ݭݬ PP`﷋P PP7ЭP֭ QQa@ PP`QPѭЭ֭ѭЭܬխ1e~DPeحݬ_QP[ݬRQP[[[ǭxeѭǭǭPĭPPP֭ԭ1*ԭ حP `֭ѭ2eԭ1ŭPPѭ1ЬЬЭP@ĭŭPPPѭЭЭP֭ЭQ֭̐a`׭ѭЭЭP֭ЭQ֭Ԑa`׭ѭЭЭP֭ЭQ֭Ȑa`PѭP׭А ֭ѭ1NrdPPЭP׭ԑ` ЭPݭݏfmJ֭7dPѭP@Pqԭ֭ѭ1_ԭS PP?ݬ PP`ݬݏf J֭cPѭP?P ԭ֭ѭխ ݭCխ ݭC^ѬyЬѭhԭUP@Э.ݭЭP@NPPЭQA@­խPЭ@֭íPѭPD^ѬP1լԬլЏfլ Џf Ьx~ AP11P@1:NPP~@P[P[@ݏgmHЏ1P@Mݏg*HЏ11<ݬ/1 a~ @PaͼݬVMP[ݬ IMP[[[maPPPP1hP `a1PP1ЬЬ P@PPPͼPQa`ͼPQa`ͼPQa`PP 1%/`PPP` Pݏ1g$F_PP;P11ݏ5gE\Nݬ ݬݏ7gEy_PPZ;P O?!P@P@,? ?P^ݏB=P ЏP1ݏ"=Pg ЏP1Uݏ<PE ЏP1ݏ<P) ЏP1ݏ<P ЏPnݏ<Pf ЏPOݏ~<PK ЏP0ݏ_<P0 ЏPoP^eWQOԭ-ЭP@KЭP@>=ЭP@,֭ѭ = ЬЏլKPxP~;PP(ԭЭP@֭ѭP^ݏݬmIP7^~ݬ:IPP` ^ լeݭݏIgݏ?gENݭݏTgݏJg-NЏ߭߭ݭP RDݭ7GݭݏUgBݏpc1^ݏ mJHWݏYgM^%Џ^x pjˋPXPߔPP@P5PPPNKЬS@^i ЏP1VPݏrgݏjgL1#ݏ@8P ݏsg2x PP`xPPxPPvxPP[ xPP8xPP%xPuPnEP~8PխMݭ3Ex8P-PЭ խ ЏP13EP~7PխݭDxPPЭ$խ ЏP1qxPPԠ(）DP~Z7PխݭyDx~PsPЭ,խ ЏP1 lyDP~7PխKݭ%Dx*PPЭ0խ ЏP1 %DP~6Pխo ݭCxPPЭ4խ ЏPdA CP~_6Pխ ݭ~CxPxPЭ8խ ЏP2gP^EݏgݏgI* ЏP1"xP P`xPPРxPPР xPPР g xPPРD xPPР1 xPPР xwPlPՠ Pݏx]PRPݠ P1Cx>P3Pݠ 6x%PPԠ xPPՠ$PݏxPPݠ$BxPPݠ$06xPPԠ$xPPՠ,PݏxPPݠ,iBxvPkPݠ,5x]PRPԠ,xKP@Pՠ0Pݏx1P&Pݠ00BxPPݠ0h5xPPԠ0xPPՠ4PݏxPPݠ4D AxPPݠ45xPPԠ4xPxPՠ8PݏxiP^Pݠ8 =AxJP?Pݠ84x1P&PԠ8 ݏgݏgUFP^   ֬^Ѭ ݬ ݏg=:ЏP1߭ݬݬQPݭݏgݏgEխЭP1{{%l}?PխTP֭ݭc6P+ݭPݼݏgݏg]EP1g߭3PP0Эݼݏgݏg$E ЏPP1 լ+ƃЏQݏ߭ݭݭݏgDݭ5P+ݭPݼݏhݏgDP1߭2PP/Эݼݏhݏ h`D ЏPP]լOݭhPݭ 5P*ݭ;Pݼݏ-hݏhDPЏP ЏP^Џ.hЏ:h ߭ݬݬ$PЭP1ݭݭݏ;hC{+ݭa=PPP`}PP`֭ݭݏChXCլ; Џݏ߭ݭP ЏP1IځݭݭݏMhCݭYP'ݭ .PݏUh7ЏP1ݭݏehBݭ3Pݭݏmh6ЏP1ݭݏhqBݭPݭݏhOBЭ Pnݏhݭ;P;ݭ/P-ݭݏhBݭݏh36ЏPݭݏhAЭ ЭP^ݬݬݬ ݬݬ-^ݬݬݬݬ ݬݬ0^ԭԭЏh ѭ 8P'ݬb,Pݏh]5ЏP1  ݭݏi@ݭݏ,iݏi@ЭP1c ݏ-i4ЭP1 խЬ м P` ЏP1k м P`{5м ݭc:PPP`}PP`֭Эܼ լkм _ݭPN Џݏ߭ݼ P ЏP1 ~9P ~ ֭ܕ~ݏHi?խVݼ 9P~4,PխݏUi3ЏP1k ݼ ݭ?9ݭݏni?ݼ PѭPPPݼݭݏwiS?խ1լ1ݭinPЬܐܭۑ:TԬOݬ}8ݭ}8}ݏi>:֭Эܬ֭A3m}~8PЏi 1|լխ ݭ,ЏP1@ݭݏi2խ ݭv,ЏP1խ)ݭݏis2խ ݭH,ЏP1ѭխ ݭ),ЭP1ݼݭݏi=ݼ Wݼ ﭾPݭCݭ+ԭѭݼ ݏi1ЏP1eѭ$լP1Qݼ ݏi1ЏP17խݼ ݏj1ЏP1ЭP1ݭݏ5jݏ'j6=խ1Tݬݏ6jM1{{ݬ'ݬ(Pݏ:j1ЏP1,JPIQIPaݏp91Sլ1м 1ݭPrB{Џݏ߭ݼ P ЏP1{6P.ݼ 6P[z5P[[z  ֭ܕ1uݼ aP'ݭ'Pݏ[j0ЏP1z ? ЭP֭*`ЭP׭`ݼ Pխ{*5ѭPPPխzݏ}j/ЏP1 խyݏjd/ЏP1ѭ1ԭJݏj:uRЭP@̃P` ֭ѭحѭح֭PQRRQbQ`֭P`ݭݏj|:խ1Эݭݏj.PЭQ֭a`vxݏj:K0%Pݏj+.ЏP1cxݏk9x FPFQFPaݏp.1UP1ݏk2FPFQFPaݏpݭݏk_-eP^ЭQ֭a`L8$Pݏk-ЏP1Pwݏ5k8uw o+ݭݏLk,ݭJ##PݏPk,ЏP1' ww w P1 1ݏnke,ݬݏkS,լkм _ݭiPNvЏJݏ߭ݼ P ЏP1v1P {v ֭ܕݼ P'ݭ"Pݏk+ЏP18+v ݼ ݏkU7 ЭP֭*`ЭP׭`ݼ ݏk$7ݼ Pխuݏk/+ЏP1խuݏk +ЏP1ݏk*ݏlݏlݭP ЏP`Kuݏl*ݏp"P *8Pt 1&^ԭЏl tѭ P'ݬ!Pݏl*ЏP1:t Hݭ}tݏ;l5ЭP1ݏHl)ЭP1խЬ At м P` ЏP1м P`{5м ݭ,/PPP`}PP`֭Э լOsЏrݏ߭ݼ P ЏP1Zs s.PZTԭ1ݼ &P~+м P]~/P֭약ݼ Pݭ0s.#s ݼ PP1ЭP1xAPqAQjAPaݏpnݏcl>(ݬݏsl,(r,ݏwl(ݏpb"P ***11~P1 ^ԭЏ}l "rѭ SP'ݬ}Pݏ~lx'ЏP1]q ݭqݏl3ݭݏlݏl2ЭP1ݏl'ЭP1խ'ݬPݏl&ЏP1iq լc`qЏݏ߭ݼ P ЏP1-qPݏl&ЏP1nq м P`7ݬWPݏlR&ЏP17м P`Џݭݼ ݏl1ЭP1 խ\Wݬݏm&ݬjpdp7ݬPݏ m%ЏP1P1>P>Q>Paݏpnݏm{%ݬݏ:mi%oiݏ>mP%ݏp"P && P1^yoݏRmݏDm06(Ro+ݼ i*Pм м м %ݏfmݏSm]0Џgm onѭ+ Pv ݼ ݏhm0ݬݏzmݏom/nICnݏ{m/ݭݏmݏm/ЭP1[ݏm#ЭP1y1bЬ լ{>nЏݼ ݏm]/ݏ߭ݼ P ЏP1m)Pm ݼ ݏm /м ݭ(PP` P`׭խЭP1%h4ݬݏm"XmRm%ݬSP ,;P;Q;Paݏp1m&(PݭݬlaP.e;P^;QW;PaݏpIݭݏm&"ݭll[lݏm-1ݏm!ݬݏm!Glݏm!ݏp=ݭݏm!ЏP2P  P1.^ݬݏ'nݬݬ ݬݬ1^ݬݏ(nݬݬ ݬݬ$^ݬ&P+%Э#Ekݏ7nݏ)n,2kݏFnݏ8ni,kѭ)ݬwPݏGnr ЏP1  PݬݏnnݏZn,jݏwnݏon+ݭݏ|nݏxn+Rݭjݏ}n+ЭP1mݏnЭLjFjP1 'ݬPݏnЏP1QլujЏݏ߭iP ЏP1iݏn+i0Pݏn+ЏP1߭ݬiݬPЭP1 լ?7P7Q7Paݏp+ QiݏnЏ)iЏP1]խ/ԭ#P`iЏP13֭ѭխYլ?c7P\7QU7Paݏp hݏn*ЏhhP1hЏyhshP1Џdh^hP1P1ЭP1 1oݬݏoݬ)ݬPݏoЏP10ggﹽ﫽gݏ,o)4լ,A6P:6Q36Paݏpw 1լ^gЏ$ݏ߭ygP ЏP1cgPݏ;oЏP1k߭ݬ1gݬPݭgݏWoO(ѭ ѭ/i5Pb5Q[5Paݏp 1ѭYլ?+5P$5Q5Paݏpa fݏboЏ_fЏP1 PPݠPK< PP QQѠ  PPݠPЭܭ ֭ѭܬ PPﲻ`ݭݏ{oWݭeeeݏo&ЭP1լ^eЏ*ݏ߭eP ЏP1iePݏoЏP1q߭ݬ7eݬPѭSլ93P3Q~3PaݏpݏoYЏdЏP1 ݏo2ݬ ݏo ݏoݏodݬݬd/ѭ~ݏoѭݬݏpBdݏpݏpHݭݏ$pЏccP2P V P1:^Ь֭ cPP^}cݏ\pݏNp$pcݏ]p$Э5cP1ݏkpWPݸЭP1ݏlpЭP1խbݏp`ЏP1P1խ/F1P?1Q81Paݏp|1wխ1oխbݏpЏP[ݏpabݏpݏp1P *777>e1^P7aaaݏpݏp)#vaP(^ԭԭԭԭԭԭԭD1/ݏp"P`  PݏqЏP1O ݏ@a!aaaaݏ&qQ"`P1 ``ݏ>q!"c]ݏMq"LFݏQq!16 ԭԭ$jR!Pѭ:YOݏ`qݏUq!>O ֭ѭ1 ЏP12 ۵PPխ&ѭ ѭ P\`ԭխ1 ѭ\խ ѭ  ѭ խ ѭ;ѭ#s[ #խ1ѭ  P`խ.-P-Q-Paݏpݭ 1 {խou P;ݏaqpPsݏzq ЏP1 ^^P1 1C ѭ{֭ѭ}׭E9ѭ  ѭ 1sխ ~R P P Ӕ ׳1 ϳXP-P{=խ5tP{fP_ `zNH1K 1`!խ/P(,`1" 1խԭ씽 P;iPݏq~ݏqЏP1 խ1߲\PŲPβPIɲ* ԭЭPQA@֭ѭ|vmgVݏqU_\xP~ P[0P[@/!P@!%\ P@ \[P1խ1ﱱխѭ?^*PV*QO*PaݏpݭD@P;/P ݏqݏqЏP1gS[M[P1Vѭ1խeP;=PݏqRݏ ryЏP1ZZP1X)PQ)QJ)Paݏp1Iѭ ѭ1*ZM{׭}֭ {խC(P(Q(PaݏpPPZP1ЏYYP1ѭW YSPLPYhPPYP,bЏYyYP1ѭ1iYX'P'Q'PaݏpPP3YPЏY YP1,X u c]WX J AwЏXXP1ѭ1 ݏr jX]&-PW]PЏ^P&Q&Pa(ݏpPW]~Џ^~ЭP֭ܐ`ݏp1խ1=ﾭѭѭﶭ/B&P;&Q4&Paݏpx13P@^WiP@i"P?PH/%P%Q%Paݏp 1P@_ >PPVܬP@ܬVV[ݏrB 館ЏVVP1խ1GyѭvPPr/$P$Q$Paݏp0171P@1e5VP@PFPP/$P~$Qw$Paݏp1v«ＫP@n KEP>PUP@UvUݏ!r ЏZUTUP1]ѭ Aխ<խ,#P#Q#Paݏp1Ǫխ ~Igԭѭ /ѭ?)ѭխcP\\`ԭwխݭܘ~ݭTݏ'rխTխѭ P`[TPP1"P"Q"Paݏpݏݏ4r ЏSЏP^ԭxPqЬQ֬a`֭SPMPDP= `4.1ЭP^ESݬP ЏP1Ѭݭݭ,Эլ-ݬEP P` ׭PP`֬ ԭY{֭}׭խԭխ!  լ*  ЭP֭ЬQ֬a`aSP^P]P ֬P^  P `P ݏ`4PЭP^^ Py Qr Paݏp~^ ݏ\r4^m1լ1 P Q PaݏpD PQPaݏp PQPaݏp-PW]PЏ^PkQdPa(ݏpPW]~Џ^~/+P#QPaݏp~^^9мխ ЏP1*ЭP֭`ѭ\ ЏP1 ѭ{֭蘽ԭЭP0֭ 917֭1֭1ЏP1P0H1Yѭ nԭЭŭPQQP0P֭ЭP֭"0ѭŭPPխ ѭЭЏP11ѭrЭP֭`~PЏPxЭP֭`~hPЏPRPPPPPPPʏPˏQQPЏխ} ѭ֭ЭЭP^09 P0P;AF P7P$af PWP ЏP ^ԭԭݬݏ`rSP7խFPUխPF109 ЭP)P P P+P-ЬP֬`ЭP^ԭ&P]~r P֬ЭP֭ЭP^լ ЏP1$ݬ PѬ  ЏP1ԭ1 PP`Pѭݭݬ PP`APHݭݬ PP`iAPPPP8ݭݬP PP`=APլЭ PPРPdխ ЏPV֭ PѭP1Gݭݬ P PP`@Pլ  P PPРP ЏP^լ ЏP1ݬPѬ  ЏPeԭP PP`P5ݭݬ PP`L@PլЭ PPРP֭ѭ ЏP^Ь۠P^ŠP^ݏ|<9|ݏr|^ݬݏʂݏ լЬP1ЬP1eݏ|1ݏ|1oݏ{1_ݏ˂S1OݏmC1?ݏ31/"#1ݏʃ1ݏ]1ݏt'1ݏ1ݏ@u8 Џm~8P@}~8͏@8PˏP~ݏ;P1ݏqu1qݏe1aݏ'U1Qݏ@|y1Aݏ‡511ݏ%1!ݏ(~I1ݏU1ݏ̈1ݏ~1ݏ} 1ݏ1ݏO1ݏ1ݏ|1ݏ1ݏzu1qݏ׋e1aݏU1Qݏd{y1Aݏ(511ݏc%1!ݏ 1ݏ{91x1ݏX1ݏ̎1ݏz1/PЭP12ݏ#ݏr1ݏя~1zݏz1jݏ|1Zݏt1Jݏur1:ݏ.1*ݏ1ݏ1 ݏhu21ݏu"1ݏG1 11ݏ21ݏ{1ݏ1ݏڒ~1zݏ }1jݏD}1ZݏN1Jݏ>1:ݏ*.1*ݏuR1ݏݏSݏN^~(3QAnq>xH!1n.>^h~A^1n~XN1jvdvP^dPЭPݬݏ\P^0PЭP1@P&0000ݏԭ1ЭP@ݏЭP@kPԭЭP@P` ֭֭ѭiPѭP P@Qa=PP'ԭ֭ЭP@Qa1lݏNP^Ѭݏ(v1UլЬP1IPЭP15ЬP1uݏ1ݏ~1ݏ~}1ݏm1ݏ)1ݏ M1ݏ 1ݏ-1ݏ`v1ݏ`1ݏ1~ݏ̞1nݏ1^ݏw1Nݏz1>ݏy1.ݏ1ݏ41ݏAI1ݏ91ݏ_)1ݏ|M1ݏy=1ݏy-1ݏ|z1ݏ?1ݏݏ1.ݏu1ݏɫ1ݏO1ݏ}1ݏ m1ݏ]1ݏ?M1ݏq1ݏ-1ݏ41ݏ ݏpݏ۰aZPЭPN:ݏMOЏP2P 0@P`pl^͘լ,Џ ͘'Ѭ3)Џ͘ ЏP1ԭѬLЏ߭߭͠ݏx ߭߭͠ݏۓݏP#ԭJ ߭ݏݏܓPխ1ѭ1ԭJѭЭP@ЭP@ЭPѭޭQRRRRQaQQQ@֭ѭ͘լЭѬЭ(mmP1ԭBޭPQQQQP`ޭPQQQQP`bޭPQQQQP`֭ѭЭP1խݏIЏP1Ѭ(ݭ/PݭݏЏP1f8ݏݭP͜'͜Pՠ͜Pݠ{P ͜PР͗ݭ_PխPP`͗͗~ݭݏ]ݭ'P~P[ޭPQQQQP[`eݏ%WԭBޭPQQQQP`ޭPQQQQP` ޭPQQQQP`֭ѭЏP1TݭޭPQQQQP`SݭޭPQQQQP`ݏ?Ѭ}g%ݏ`ݏPjL%U>%PE.%P͗2%P͕͖͕ޭPQQQQP`4ݭޭPQQQQP`ݏa֭ѭ͘_͘ݏrԭBޭPQQQQP`ޭPQQQQP`ޭPQQQQP`֭ѭ1l^הx߭ݏݏPѭ15խЭP1zݭP  ݭݏ<ЏP1Oݭ߭߭ݏݏ9Pѭ1խЭP1 ݭP  ݭݏЏP1ݭ߭$߭ݏݏؔPѭVխЭP1ݭP  ݭݏ]ЏPqݭ߭,PЭPQ߭ݏ(߭ݏ(߭ݏ(Z#PPPV#T#P^ԭԭ_#^u#I#c# 9#>ŶխC#P@խ ЭPРp " ^AݏݏOݏTPЭPdѭ- ߭ ݏݏﮮPխЭP1PЭPݭgP"Э"P ^ݏݏZＥݬ~ԭ-ťݏ!ݏ ݏbPխ7ѭЭ;ѭ ݏ"7%-ﲦЭPխݏZЭP^ݏ>ݏ=?ݏvPЭP1=C2y2PЭP12-Pݏ?2&PbVf'J" ЏW~Џ\~ݏDG#", ݏ]("eeP1߭m1ݏjPe/խ Џ~Џ~ P഑ݏy%խ + P഑ݏíee_eP^Y߭ݏݬNPЭP+ݭ(~Pݭݬ$eeP ^Ьݏݏݏ˕ݏѬ1^ VPmPPP@@ݭݏ֕ݏ̕^խCЭPˏpЭPˏpwЭPpPPPG \TPݏו,ﶨ1WխЭPݠݏ#ЭPݠ$ݏ#ЭPݠ(ݏ#ЭPݠ,ݏ#ЭPݠTݏt#ЭPݠXݏ`#ЭPݠLݏL#ЭPݠPݏ8#ЭPݠ<ݏ$#ЭPݠ@ݏ#ЭPݠDݏ "ЭPݠHݏ"ЭPݠݏ"ЭPݠݏ"ݏݏ"ЭPРlЭPРpЭPР81  ݰ~аΰ ưcﹰﷰ ﯰH԰ ̰-￰ｰ ﵰ侮聆  z xki aTR J=; 3p&$ U  :¯ ﺯﭯF^ݏAݏ1﷦ݏ|P1ݭݏRݏBѭ1:,ݏiݏYy/, ЏP1T߭,ݏĩPѭ+ݏj^ЏP1 խ+ݏ<ЏP1+PЭP1ݭ__P1ЭP1ЭP1jݏɖݏݏnPЭP1rPЭP1^Эn_h_P1EԭԭCfݏݏזݏ(PѭЭP1ȭѭЭS@^^P1ݏ*ݏPѭ ݏЭP1PЭP1k ɬìF ЏKﱬb^\^P19ݭ21,Uݏ ݏ{ݏĩPЭP1ѭ)2ݏ+ݏ?ݏĩﺽPЭP1PЭP1{ѭӬЭPPPbݭ]]Pqݏ3ݏ%\4Pm]LݏNЏP6Pj8^լ2ݏoݏnݏﹼPЬP1e ЬP1 ݏ\1N ݏpݏZ18 ݏݏD1" ߭ݏݏPխѭЭP1 ݭ!PPխ({!PP`}PP`֭լMԭ!P`%PP`s ֭ѭѭ%ݏЏP1[ 80#լ#~P ݭ'[[P1 ݏp﹊1 x߭ ݏqݏMPլЬP1 J߭ ݏݏsPլЬP1 PЬP1 ЭЭR߭ ݏɘݏPݏݬݭݏO19 ݏ`1) ݏdۉPЬP1 ZyZP1 ݏxﰉPխЭP1 ݏ|PխbUЭP1 ݏtY1 1 ݏ͘ݏ̘JݏﭹPЬP1Y ЬP1ݏϘݏΘݏXxPЭP1$ լ Џ~Ѭ Џ~Џ~խ Џ~Џ~ݏҘ>%#խMլ'%ݏ1 Ѭ %ݏ1 $ݏ1 լ$ݏ1k Ѭ$ݏq1O $ݏ[19 ݏݏE1# ݏ5ݏ/1 ݏeݏ1ݏݏ1ݏݏ1ݏՙݏ 1ݏ ݏ1ݏ7ݏ1ݏdݏ1sݏݏ1]ݏ"P '=SiݏΚݏ͚ݏRPЬP1PЭP1ЬRWLWP1RݏԚݏӚݏ܎PЬP1'PЭP1Ь:VVP1v߭ ݏݏܚPݏ?ݬݭݏ N18߭ ݏ.ݏ]Pݏݬݭݏ 1ݏ1ݏPЭP1￤o﷤`P^ݏPS( ݏs=/ ݏ'm eXЏP1cЭP1\ݏPU1EݏݏݏXkPЬP1PЭP1ЬkUeUP1ݏݏPѭЭP1ﯣ1藍IPHݏϛ<+ ݏ&p h[ЏP1bݏE"P1=ݏݏ̓ݏݏēm?VP1ݏ#P ݏݏ"ݏ1ݏ$yVPRݏ(EP<P8Zݏ1ݏ̓7ݏ3ݏēZ"%Pݏ7%Pۡݏ9͡CS=SP1ݏ<ݏē1ݏYݏȓ1ݏvݏ̓1ݏݏГ1jݏݏԓv1Tݏ՜ݏؓ`1>ݏݏܓJ1(ݏ6ݏ41ݏ āPuR1ԭ1v߭ݏݏ[飼PlխYݭPխB~P[ޭPQQQQP[`ݭޭPQQQQP` ֭ѭ1pѭ1ԭ-ЭP@ЭP@rЭP@`֭ѭQЭGԭЭPޭQRRRRQa@*֭ѭVQPQP1ԭ0ޭPQQQQP`ޭPQQQQP`&֭ѭЭP1ݏݏ1|ЏݏݏݏTPЬP1Bլ2ݏǝݏƝݏ|_PЭP1 PЭP1ѭЭЬMPGPP1MݏНݏϝݏ(PЬP1"PЭP1ЬmOOPrݏ՝ЏP\P* Qa/ZZ6 , ^n0F]^ݏ)  P@PPPխ1ɝ ~н~ݏ5ݏ( ݏ= ݏ% ݏ  ݏ&ݏ/ ݜPЭPРpPPխݏH1 ݏP ݏTo ݏY\ ݏ]I ݏa6  ݏe#ӏ@ ݏk ӏ ݏqӏ ݏuݏy PЭPРlPPխݭݏ ݏ ЏŞ~ЏȞ~ݏkq Џ~Џ~ݏ̞F4 Џ ~Џ~ݏ! Џ*~Џ2~ݏݏ<ݏVFݏ\.ʚݏfﲚ  ݏo Џ~Џ~ݏum wPЭPР8PPPݭݏ<PW]~ݏݏB ~*~ݏ% ~ЭPР~oM  ~*~ݏ ~ЭPР$~2MЙ ~*~ݏ3yﳙ 龎~ЭPР(~L ~*~ݏN<z r~ЭPР,~L ~*~ݏiu m~ЭPРT~{LY ~*~ݏ< 4~ЭPРX~>L  ~*~ݏ ~ЭPРL~LPPP֭PѭPPP1ԭﯘ ~*~ݏ ~ЭPРP~K֭PѭPPP1KԭV ~*~ݏՠ5 -~ЭPР\~+K֭YPѭP;PP1ԭ ~*~ݏNؗ З~ЭPР`~J֭PѭPڿPP1ԭ ~*~ݏ { s~ЭPР<~iJ֭PѭPyPP1(ԭ; ~*~ݏ& ~ЭPР@~J֭6PѭPPP1ԭޖ ~*~ݏA+ ﹖~ЭPРD~I֭PѭP﷾PP1fԭ ~*~ݏ\d \~ЭPРH~FI֭tPѭPVPP1ԭ( ~*~ݏwi  ~ЭPР~H֭PѭPPP1ԭÕ ~*~ݏ秊 ~ЭPР~H֭PѭPPPDԭݏ-`S7Pݏ ݏP,^ݬݏݏx+\լݬݏDЏP1SЏ [߭߭ݏwPݏ  [ЏP1Џ,[߭߭ݏآ6Pݏ ~[ЏP1ݏ [ݏmݏ,[ݏVݏ,[﹧Pݏ%hЏP1wѭ菀Q1ݏ [߭ǏQ߭P߭P߭PЭP@ѭPPPP֭PPbЭPí@WQQ֭ѭ ֭ЭP@7ѭPPPP֭íԭPP­ԭЭݭݭݭݏMݏ [ǏQPďQPPPPݭݏZݏ,[ݏ [ݏ^ݏ,[ݏqЬYP^ԭi߭ ݏݏWPAխ1%ݭ ݏUѭ1P ЏP1ݭݏP ЏP1 PЭP1ԭP`ЭP@֭ѭP1ѭjݏݏp/q~>,APV~v=խݏӣP1ݭEЭP1խ ѭݏݏZЏP1ѭݭݏ 6ЏP1խ-ݏݏZ$ݏ;խ (߭ݏݏSĝPխЭP1KݭZPԭԭ1խ1P`K P`kѭPP`\$ѭ0PP`\!PP`\ЭP֭ P\`ѭ@PP`{1PP`\"P P\`ЭP֭ P{` PQa`֭ЭP֭P`1&ЭP֭ P`{ PPo DP PPѭ߭߭E ֌P)ݏiխ ݏZ3~ЏP1 PPЭP@ ЭP@ ЭP@ ݭs P`n P`_ P`ݭtP~P[ЭP[@ ЭP@{ ݭЭP@k  Pխ ݏZV}PP^լݬݏǤ߭0߭߭ݬhPЭPLݭPGݏGݏ̤ЏPݭݬ [Ԭ ЭP^ԭԭޭ@d<84͌0D,d͌Dkݏݏݏ4 PЭP18խխݏ@ЏP1@ݏ1xP`PѭЭP1ЭP1<ݏtxPdePѭ1ЭP18ݏxPh/Pѭ1ЭP1j4ݏxPlPѭ1ЭP140ݏ)xPpPѭPЭP1,ݏgxPtPѭЭP1ΤPЭP1@@UP@<<UP<88xUP844bUP400LUP0,,6UP,,048<@ݭg<;P^ݏݏݏؒPЭP ǣPЭP ЭPH^ԭԭԭѬF1߭ݏݏaPЭP1$ѭݏeЏP1$֭葽  ݭPЭP1q$葽|PPP'֭֭葽 PP QQQP(ݭIPݭݏ٦ﺻЏP1#nfYݭ+Pխt~﮳P3-ݏZЏP1#ݭ ݏ ݏ+ݏ99P1H#ЬP1ݏ,ݏUܺ99P1#ݬﶗ1 #ݏݏݏFPЭP1"vPЭP1"լ?ݏխ Џ~Џ~ݏݏSrPP1"Э98P1k"U1a"P<<<<<S<<<<<<<<<<<<<<<<FЬP1=ݬߞ1 "1"ݏݏݏX=PЭP1!mPЭP1!Э`=808P1!ݏggP81!߭ ݏݏ~Pѭ ݏЭP1F!խ/x-ݏɧ ݏѸЏP1!ѭPݏﰸЏP1 ݭݏ+߭?u߭ ߭ݏ.~PЭP1 խ/-ݏBP ݏhAЏP1 ѭ܏Pݏ ЏP1a PЭP1M ݭݭaPЭP13 v7L2{PѭЭC7LPѭЭE6?6P1Eݏݏݏ PЭP1PЭP1lЭլ`ѭBPݭݏݏݏݏSP^XP155P14Pm51P>+~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~Q~~~~~~~~~~~:ЬP1߭ ݏݏ{PխЭP1&PЭP1խݏﵵP1ݭݏݏݨdݏ'ݭc4^4PPPHP~cP@41;464PPP$P~gcP41ݏݏݏxPЭP1VЭP1߭ ݏݏzPЭP1$ѭ#ѭݏ33P1PЭP1ѭ ЏTѭ ЏTI3C3P1I߭ ݏ[ݏ/yPЭP1!PЭP1sݭpP21_ݏT'bP21HݏhEbP211߭aPЭP1ݭЭUsխ Џ̑PPPw2q2P1w߭ ݏݏ^yPݏݭݭݏHa19߭ ݏݏxPݏݭݭݏDa1dЏP1ZP %v&P'""""""""""""""ЬP1)?P11ݏݏsݏ8PЭP1hPЭP1ЭPska #11P1ݏ-P/)PPP01] 00P1AP߭ ݏשݏrwPխԭݏݭݭݏ`Pz01P1PP41ЬP1ݏ.1D1Gݏکݏ٩ݏPЭP1PЭP1nЭ//P1Uݏ_P/1>ݏߩݏ`P/1 ݏݏyݏpDPЭP1ЭP1j߭ ݏݏvPݏݭݭݏX^P/1%ݏݏwyݏƎPЭP1\PЭP1HЭiC..P1/ݏ<]P..P1ЏP1P0u:P1AP1P1'P01P@1xPE1ЬP11ݬ`1Bݏݏ8rݏ0PЭP1yPЭP1eЭ(LF=760'k PPP^Tݏ ݏ{-z-P1ݏ ݏ qݏd!PЭP1ѭXD߭ ݏݏsPЭP1ѭѭ!ѭݏЏP1UPЭP1AѭWPPPvЭr,,P1ݏKݏJݏTLPЭP1ЭPIݏ[[PU,1P,K,PPP=P~|[P-,1ЏP1P+P1P 1P 1P+1WPBЬP1ݏMݏLuݏPЭP1#ｓPЭP1Э@ {|+v+P1߭[ݏRrPЭP1ݭKDPݭ9i.+(+P1.߭ ݏݏkqPխԭݏݭݭݏ}ZPЭP1G^aݏ**P14ݏeլ0ݏhݏݏS｝P.(P1ЭT*N*P1TݏݏuݏАPЭP1ЭP1 ݏªů߭ ݏŪpPЭP19խݏܪP1"１PЭP1ݭݏYլ0ݏ%xݏ!ݏSﱜP"P1ЭA);)P1ݏrXP#)1/11}ЏP1sP$P x ЬP1ݏ'ݏ&ݏ rPЭP1ЭPxݏYWP{(1v(q(PPPkP~WPS(1<C(=(P1<+(%(P1ЏP1Pݏ)ݏ(ݏl︇PЭP1NЭP!ݏYWP'11ЏP1'PP(1PAЬP'aPխPPPt'ЭP1P!ЬP1ݬݬe1Wݏ;ݏ.kݏȉPЭP1(PЭP1zЭ'&&P1aݏ@&&P1<ݏXݏoyݏiݏPPѭ ݏЭP1iPЭP1ݏ[-&'&P1 ѭFЏKݭ P ݭݏΫ%%P1P Pwq#gݏڦ%%P1%C%;4"ݏXݏ ݏXݏP%J%P1Pݏ,ݏ+VqݏPЭP1ЭP1Nݏ;ݏ:ݏX＄PЭP1RխPЭP191ǿ߭ ݏbݏ<kkPЭP1ѭ!ѭݏdЏP1 u߭ ݏݏkPЭP1 ѭݏUЏP1 0PЭP1  ЭЭ##P1Z ݏݬݏܬ7pݏPЭP1( ‹PЭP1 ѭPPPѭPPPr#l#P1 1 hݏݏݏt PЭP1 =PЭP1 Э ##P1v TU1l ݏ4R1\ ݏ&$R1L ݏ&R1< ЏP12 PS]2P...DD....[...........TЬP1cl1 h1gPЭP1 ݏa3"-"P1 3ݏ!ݏ ݏ؁PЭP1n PЭP1Z Э{!!P1A :м߭ ݏPݏ(thP ݭݭ߭.QP<߭ ݏsݏR:hPݏݭݭ߭PPխЭP1 > ѭ, PxPqլlЭxPHݭݏt辶ݏ{ݏwݏSPwqP1 Э5xP'HPPPP !%Pѭ)ЭE ݏ|B  P1| P$7000000000000000000000ЬP1"غݏѭݏݏ}PЭP1 ЭPs鷺߭ ݏ ݏحHfPݏ?ݭݭ߭NPխЭP1խԭЭֺ;5P1ЏP1P*ݏ3ݏݏ~PЭP1eݏEPխݏ4ЏP18ԭЭPЭQA@֭ѭЭP1S߭ ݏQխ ЏV~ЏӮ~2eP1ѭ1Dѭ1Sխ ݭ:ԭݏRݏeP5ݏizPݏlaP1ӅPЭP1%ЭP@֭ѭ ЏЭP@֭ѭ氭OխJfݏnoݏb P1tݏܯЏP1]խ ݭЭP1Gíѭ ѭ%ѭ ѭѭ ѭ)ݭݏ﫝խ ݭЏP1ˏխHխ:ѭѭ.K ݏ0Tխ ݭ)ЏP1ЭP@1lԭЭPЭQA@;֭ѭխ ݭߖP15ЏP1+PP1PD1ЬP1ݏ|ݏYݏ<@{PЭP1ЭP1ݏ\JPH1ݏ}`ЏP18߭ ݏݏaPЭP1vPЭP1bѭ ѭ?ѭ_3ѭ)ѭ wP1ݏЏP1P/F]Џ6߭ ݏݏװ$aPխ1ѭ1PխݏDЏP1ޭ߭ ~[|ŏP[~G|)5-լ Џ~Џ~gPѭԭЭP^~ݏԭ1P2@ ~~ЭP2@~ݭݏ@Õѭ2~ݏU突 ݏ_P2@~~P2@~~ݏhYѭ2o~ݏ}?ݏ2֭ѭ15ݏ^ծ#ݏ"P￮ ݏPݏ冷1ѭ1ЭP-ЭPݠP1Џݏ_mhRЭPݠݏ5ݏݏ6^P爛9R ЭPРݏݏzK׭1нP`=1нP`-1нP1~ݏݏQP1ЭP ݏЭP׭ѭ нP`- ݏｄݽטP? ݏ ݽݏ,11}1s1ݏ P1ЭP׭ѭ ݏ(1լ1ݽ %phfPM-pz֭1v׭1@^$aP^P^1)ѬЬJ ݏNݏ;_PЭ ݏbݏO1~# 1n ݏvݏc PP~ݏwn|1! ݏݏ︜F>ѬЬ*PЭݏݏh:~Z 1ݪت ЭP^խѭ ЏPEԭ- Pȩ P̩ PĩP֭ѭ wЏP,^ ݬPݬݏЭP1Џe+߭ݏXP ݏXݏTЭP1խ PЏPPhEPPPݭݭPݏЭ(P1:4_eݭPݏﺎЭP1ԭݏh4cP]ԭ1q]ݏ rԭ1cN>P7`PʏP|Pݭݏ"ݏѭ1խԭ1bPP?1~PVPݏ#Սԭ1U! M!:,!1I"-PPPP~ Pԭ1~pPխԭ1fԭNPѭ2ʏq-PPPP~e Pԭ1 ֭ѭح1ѭ 1Џխ*i "a ~yP[ЭP֭P[`խP}P`[ H[P :P[ЭP֭RP[`  ѭ؏~P[ЭP֭P[`1ѭ1meӏ[ﾧP[ЭP֭P[`~P[ЭP֭P[`P[ЭP֭P[`~aP[ЭP֭yP[`ѭxѭ  ѭ1~RJP`ݭݭݏ>8ݭݭPݏKNԭ1?ԭE= [+(Эܭ֭ؕݭPԭ1~ vcaѭ [ԭJZPԭ10-P%,ʏ~Pԭ1PѭPgXP5P1ʏ~wPԭ-gPխԭѭ1խ1N)Џ*ЭP֭ܘ`~}PHݭBЭ/ЭP^ԭЬP1w߭ݏyݏ^UQP1T߭ݏݏ2QPl2߭ݏݏQPJ߭ݏݏPP(ݬݏЏP1MPY|խЭP13ѭݭݏˆЏP1rݏݭF@P$ЭPՠЭPݠ%P ЭPРݭ3؍&Bݏ@ݏ4ݏhfPЭP1ЭoPЭPuЬPaݭݭPYݭݭMPCݭݭP-ݭݭPЏPP^ P1լTVVVVVVVVVݏݬ P=ݬ P$ݬݏhpP^^ P1լTVVVVVVVVVݏȕݬ Pݬ Ptn^ݬݏh︋ػݏD-~ݏU~߬ݏVݬ}P^Z P1լTAU?U=U;U=U;U8U6U4UݏݬPݬPlfݬݏhﴊ4FP^ լTTTTTTTTTTݏݬFP˾ݬ-Pﲾמּ^ݬݏh&ݏWKݏb4߭ݏcݭ:@P^ЬPЏdЏiЏp PЭP ^ݏqݏXݏǃ[ݏXݏﲃPݏ,"ݏ|ݭݏjݏ]﻽ݏH ݏ9Pݏ1ʼ ݏﴼ ݏ=ݏ͂%љݏ﵂ ݏ廬X  ݏB ݏ9z ݏGd¼EڻPPPѭPPPݭݏY ݏp ~mPݏtݏ~zݏˁ ݏ！ݏ﯁9 ݏ1  ݏ1ݏg1ݏO1ֺ! Џ~Џ~$gךּ!Ǻ Џ~Џ~=! Џ~Џ~ЀXݏﻀݏﮀ@<ݏ ݏ1'K Џ.9 Џ& ЏЏݭݏ !*ݏ ݏ*ݏݏ:͏@dPˏP~UݏI^ݏg^)չ^լݏDkO81-P%QPaݏp~`m~ݏ~ЬP֬`ݏ~ ^Kݏ~K'9 1~Џ~ݏ~<ݏ{~ԭ ЭP@~ݏY~֭ѭKݏ?~MKݏ *~.6Kݏ~K ݏ}< Џ<~Џ?~ݏ$}J Џ{~Џ~~J Џs~Џw~ݏC}ݏ}ݏr}dJ\JݏW} ݏH} z~Џ~ݏ#}@@ Џ7~Џ:~Џ>~w@ Џ/~Џ3~ݏ|J J~Џe~ݏB|J J~Џ~ݏl|I I~Џ~ݏe|?? Џ~Џ~Џ~ݏ.|?%? Џ~Џ~ݏ|GI ?I~Џ~ݏ{ݏ{ݏ/{Uݏ>{=ݏM{%;ݏTq{ ݏZb{H H~Џ~ݏ]={H H~Џ~ݏ{fH ^H~Џ~ݏzEH =H~Џ~ݏzݏzO>ݏ%z*ԭЭP@2>ݏ,z֭ѭ>G G~G G~ЏT~ݏ0JzG G~Џ~~ݏ[%zG G~Џ~ݏzfG ^G~Џ~ݏyP^  Џ~Џ~ݏyݏyӳPЏЏЏ% Pݭݏ'Xy Џ+p Џ3Џ=ݭݏGyM Џy~Џ}~ݏ`x, Џ~Џ~ݏxݏxԭ PP+ ֭ѭѭ Џ~ PL+~ݏrx Џ~ Џ~Џ~ݏ;xﹲ Џ~Џ ~ݏxh~~ݏwݏ.wݰP?ݏHݏDwJݏOݏKw5ݏVݏRw P ݏ[rwPTݏuݏqVwKݏ~ݏzAw6ݏݏ,w!ݏݏw P Џh~Џ~ݏv Џh~Џ~ݏvɰ Џh~Џ~ݏv侮 Џh~Џ~ݏuv Џ;~:~ݏPv ~Џ`~ݏB+vЏ߭߭ݏgdAݏru_ݏuPݏu^xP8ݏuz1Sݏu2!" ݏiuݏ!Huڬݏ>5uݏXu֬ݏpuﾬݏto~d~ݏtxݏt~~ݏt ݏt~~ݏztD8ݏ&_t參ݏCLtݏY9tݏbtxvݏztiݏszpݏsݏsݏsX Џ~Џ~ݏsﻫ+ݏﱫ Џ ~Џ~ݏVsݏIsݏ(s ݏ=sxP`ЏVЭ~Џ{~ݏWrxﱬPdЏЭ~Џ~ݏr Џ~Џ~ݏr̬iyPݏfrMyPݏJr1uݏ2rxPhխЏ!Э~ЏE~ݏ"qxǫPlխЏLЭ~Џp~ݏMqxPpխЏwЭ~Џ~ݏx~qxOPtխЏЭ~Џ~ݏBqxP`խЏЭ~Џ~ݏqxתPdխЏЭ~Џ~ݏp^ݏ#p^ݏ/p4ݏPݏLvp~ݏj]pݏJpݏ7pݏ$pʨݏpﻨݏotݏ$oeݏBoZݏ`o7ݏ~o0ݏo511~[Pݏwo ݏboݏIoݏ*mЏZP1ЭP@ ЭP@PЏ[PPݭ9gP{!P}PP`֭A ЭP׭P`խP` P` ֭  ߭߭ݭx,P^ݭݏwݏ\lԭ0ޭPQQQQP`ޭPQQQQP`Z֭ѭЏxP1ݭޭPQQQQP`ݏybl֭ѭ 1(MԭAݭЭP@ݏ.lݭޭPQQQQP`ݏ l֭ѭ ЭP1ݭUPѭ PPРPЏPPԭ0ޭPQQQQP`ޭPQQQQP`Y֭ѭ խЭPЏP1ݭPԭ0ޭPQQQQP`ޭPQQQQP`?Y֭ѭ խЭPЏP1nЭĭݭdPЏխ1 ֭ЭP׭ Эԭ  ֭֭ѭ둽 ЭP֭`֭ Џխ! ݭ$TPЏѬ UЭĭ;ݏޭPQQQQP`ݭdݏݏݭd֭ѭ ЭĭЏխ1 P Pݠݭݭ@P1PI@PЭխgP@խЏ>ݏݏ_iݏ]PЏԭ0ޭPQQQQP`ޭPQQQQP`W֭ѭ խЭPЏP1MЏp"լ `ݭ=Pݭݏݏp"aԭ0ޭPQQQQP`ޭPQQQQP`V֭ѭ ЭP1Џp"ݭԭ0ޭPQQQQP`ޭPQQQQP`AV֭ѭ խЭPЏP1pѬ 1ݭaPЭȭݭaPխ ЏP17խ ЏP1(íխPЭPPѬ RݭPݭhXP6ݭ<PխԭխЭPíPPPխԭ\P@Lխ~~ݭݭݭ(Pݭݏݏp"_Џp"Џԭ0ޭPQQQQP`ޭPQQQQP`T֭ѭ ЭP1Џp"Ѭ ݭݭB`1ݭe`PݭW`PѬ P ݭ?`PíPPѭ խխݭݭ_1Эĭl?P@/ݭݭݭ]`P7ݭݭݭP!խݭݭݭ`譼쭸ЭP֭ЭQ֭a`ЭP׭PЭP֭ЭQ֭a`ԭ0ޭPQQQQP`ޭPQQQQP`S֭ѭ Џp"ЭP1ݭ﵉PݭVPGݭM:Pխ*ѭ Џp"ЭP֭`Џp"ЏЏԭ0ޭPQQQQP`ޭPQQQQP`R֭ѭ ЭP1Џݭo^P&Џp"ĭˏ~ݏݭQ]ԭ0ޭPQQQQP`ޭPQQQQP`WR֭ѭ ЭP1Џp"ݭ]Pݏݭ\ԭ0ޭPQQQQP`ޭPQQQQP`Q֭ѭ ЭP1-ЭĭЏp")P]~^P֭֭Ҕԭ0ޭPQQQQP`ޭPQQQQP`mQ֭ѭ Џp"ЭP1ݭPխ5ݭ7Qݭ\P~vOPݭݭ\ЭĭݭNPݭSP1ݭSPzݭ7Pݭ7PЭP1ѭЭ-ѭЭǭPĭPPPP PЏp"ݭݏݭ/[Џԭ0ޭPQQQQP`ޭPQQQQP`+P֭ѭ ЭP1hѬ  ݭVЏPPխ5ݭOݭ[P~-NPݭݭT[ЭȭѬ  ݭЏPPѬ ݭR[PݭMP(ѭ-Ѭ 'ݭ*[PݭxMP Џ1Џp"ݭZPѭ8Ѭ  ݭ%6ЏPPѬ  ݭ6PP/Ѭ  ݭ5ЭPPíPPѭխ4ѭ-PPԭ֭ѭЭP֭ЭQ֭a`㔽Џp"ԭ0ޭPQQQQP`ޭPQQQQP`XN֭ѭ ЭP1ЭĭЏp")P]~,[P֭֭Ҕԭ0ޭPQQQQP`ޭPQQQQP`M֭ѭ Џp"ЭP1 Џ ݭPݭ`PP1ݭ4PխqЏp"ݭ)YPխSԭDЭĭԭ0Ïp"PP Џ ЭP֭ЭQ֭a`֭ѭ֭ѭԭ0ޭPQQQQP`ޭPQQQQP`L֭ѭ Џp"ЭP1 Џp"߭ݭԭ0ޭPQQQQP`ޭPQQQQP`L֭ѭ ЭP1 ݭ廒PѬ Џp"ݏݭݭX1ݭNP1ݭ3Pխ1Џp"ݭWPѬ  PPPѭЏѭЏѭЭѭ3ݭݭݭ$XЭЭP֭`֭ѭ4­ԭЭP֭`֭ѭݭݭݭWԭ0ޭPQQQQP`ޭPQQQQP`K֭ѭ Џp"ЭP1I Џp"լ [ݭUPݏ ݏp"Uԭ0ޭPQQQQP`ޭPQQQQP`J֭ѭ ЭP1 Џp"լ [ݭ#Pݏݏp""Uԭ0ޭPQQQQP`ޭPQQQQP`(J֭ѭ ЭP1e Ѭ 1ԭѬ 3ݭGPݭLPݭ0PխԭЭЏȭPԭЭĭ֭խ"~ݏݏp"HTЏp"֭ЭP֭ԭ0ޭPQQQQP`ޭPQQQQP`5I֭ѭ ЭP1r լ 1ԭѬ %ݭKPݭ/Pխԭ~YPԭ0ޭPQQQQP`ޭPQQQQP`H֭ѭ ЭP1ЏݭDTPhЭĭЏp"IPPPˏPЭP֭ЭQ `ЭP֭`PˏPЭP֭ЭQ `Џp"ԭ0ޭPQQQQP`ޭPQQQQP`G֭ѭ ЭP1"Џݭ~SP1eЭĭЏp"1Bԭ1ޭPQQQQPЭQ֭a`ޭPQQQQP` Џ1ޭPQQQQP`P]/ޭPQQQQP`>TP[ޭPQQQQP[`ޭPQQQQP`0*ޭPQQQQP`9ޭPQQQQP0`QޭPQQQQP`A.ޭPQQQQP`FޭPQQQQP7` Џ;֭ѭ1ЭP֭xQQQQRRQ`1Џp"ԭ0ޭPQQQQP`ޭPQQQQP`F֭ѭ ЭP1\ԭЭĭЏp"7ЭȭЭP֭`խЭP֭ЭQ֭a`խЏp"ԭ0ޭPQQQQP`ޭPQQQQP`~E֭ѭ ЭP1ЭĭЏp"ݭQP11Эȭ4P@$P]~&RPԭ9P@P]~QP ЭP֭`խЭP֭ЭQ֭a`1_Џp"ԭ0ޭPQQQQP`ޭPQQQQP`nD֭ѭ ЭP1լ 1ݭPPЏѬ ЭȭݭOPѭ Џѭ-Sݏݭݏp"zPo"%Э֭약 ׭ѭp"DЭĭ"Э֭֭약ݏݭݏp"OЏp"Џ!ԭ0ޭPQQQQP`ޭPQQQQP`1C֭ѭ ЭP1nЭĭЏp"ԭ[P]Cխ"P]~OPP]~OPЭP֭`ЭP֭`ԭ0ޭPQQQQP`ޭPQQQQP`qB֭ѭ Џp"ЭP1Џp"ݭPݏ#ݭLԭ0ޭPQQQQP`ޭPQQQQP`B֭ѭ ЭP1?Џp"խݭݏݭԭ0ޭPQQQQP`ޭPQQQQP`A֭ѭ խЭPЏ'P1ԭխЭPЏ(PPЭP֭`PPݭݏ)ݏp"Lԭ0ޭPQQQQP`ޭPQQQQP`A֭ѭ Џp"P1A խ!ݭkPݏ-ݏp"Kԭ0ޭPQQQQP`ޭPQQQQP`@֭ѭ Џp"P1խ ߭ݭԭ0ޭPQQQQP`ޭPQQQQP`=@֭ѭ ЭP{Џ0PrP5AZd![O% L/-^߭Mխ Џ1P1ЭPQa0֭ѭЭP 0PЭPPPAЭP 6ԭ"ЭP@;~QKP ֭ѭ ѭ ?-֭ѭ 0P1PP P PPP0PЏDP^ЏX߭߭ݬ P Џ,ЏX߭>ݬݏlAPP1~~P@&PPPЭP1P@(ݏ2ݏXHЏXP1{|ݏ5ݏXHЏXP1XP@Žݏ8ݏXHЏXP1-߭_խP1ЭPЭP  ЭP|ЭPqЭPf `ЭPQaK֭ѭ?ЏXP1oPݏXHЏXP1z1pЏxP1f@{ ЏP1Tݏ;ݏXYHЏXP17ݏCݏXP1 Pխ ЭPРXPЏ?P1 Pխ ЭPРLPЏ@P1 Pխ ЭPРPPЏAP1b Pխ ЭPР\PЏBP18j bPխ ЭPР`PЏCP1D <Pխ ЭPР_!ePsRU}n~*M6SS'~&0:Lg9c 5_uFPk1.^ԭԭм м00d ݏyk40ЏP1լխt0ЏP1ݬ9Pݭݬݏ?խ90ЏP11wѭ\)ЭP֭ЬQ֬a`ЭP׭P ЏP1h1DЬPЭP1ЭP֭ЬQ֬a`ЭP׭P ЏP1/1 ЬP֬`ԭԑ0B9<P@h#(Pp(PQ0QQQQQQP`P] ۘP@#խ߭߭ݭ`P ЏP11m߭߭ݬeP ЏP1pԭ[֭]׭֬]֬ݭݭgPZ_ЭP@CЭP@``/ЭP@`$߭߭ЭP@`P ЏP11|ԭ(֭֬֬ЭP֭P@֔ѭ@֬()֬~*PPݭݏݏy=խ-ЏP10' 'd+~)Pe'_'ݏݏ=D'p-ЏP1)'ԭdPЭQ֭QQQQQPЭ`ԭԭЭP֭`1{֭}׭(խ֭ĕi)խ׭ЭP֬F,7խ2ѭ,ѭ ֭֬1|dPЭQ֭QQQQQP`֭֬1Vݭ|ݏ<9&ݏ;խ4ݭݏݏ;խ ݭ)ԭЏP1i4ԭ(ݭdPQQQQP`ݏ;֭ѭ%ݭd|!Pխ0ЭP׭P ЏP1 ЭP֭ЭQ֭Ԑa`׭֭խ%ݭݏ0ݏ;ݭ))ԭ1̑()ЭP֭ЬQ֬a`ЭP׭P ЏP11֭|ԭ)֭֭֭̽ЭP֭P@֔ѭ@֭̕))֭Э̬|<4P~&Pխ8|ݭݭ3Џ@߭߭ݭݭ7(ԭ|ݏ1:ԭѭ$|o!P`ѭm ѭM=_|ݚv#Pѭ PｚPРԭ|Pխ?$ЭP׭Pխ ݭ'ЏP11ЭP֭ЭQ֭Ԑa`׭֭խ ݭR'ԭ1߬^'Pխ%ЭP֭А`խ ЏP11ЭP֭А`ЭP׭P ЏP11PV1JP&1 P$1 P1)1xP%1G1mPM11\PF11MPm1jPf1c10Pv1M1!11(ЭмЭ P^ݏ $P' ЏP;PԠPԭЭP@r֭ѭ@PX^qF1@ݏ$Pv ݏEݏ#Pv ݏ1"ԭcvP`ЭP@Uv֭ѭE#ݏ#PE ݏPԭEP`֭ѭzE%ЏﲿP ݏsݏ1#Pv ݏ_ݏ#Pﯜ ݏ<ݏ"P|u ݏݏ"Pm ݏݏ"PN ݏݏ"Pu ݏ"ݏ_"Pu ݏ?ݏ<"Pt ݏ\jC#ݏ"PC ݏy?ݏ !Pst ݏݏ !PLt ݏݏ !PYu ݏԭЭP@֭ѭP ݏssssէ ΧPtP` ｧPtPԠ 﫧PtPԠЏbԭЭP@֭ѭ fAot)vBݏ  gBݏ XBݏ PEBݏ! 6Bݏ* ݏtݏ1ݏݏ7ݏݏ<ݏݏCݏJ߭=-߭߭߭ZPѭ;ݭ~qYԭ"ݭݏR߭5,֭߭ѭ ؔ?`ݏZ߭,߭߭߭'ZPѭHݭ~Xԭ+ݭݏb߭+ЭP@_߭f֭ѭ_˔pP&```@`@P+A,A^AA^@L?17qRqLqʹ6@8q+P q@/@q+q/ݏjp+?p*pݏl1ݏxp%P*1__P@AopD+P~P[`_P[@oCpI_P@Y*ݏ"p4?+'!P@P@PQAo@oPQA@ߖͣPţQAo@oﱣP謹QAo@oPQAo@{oyݏݏzT0 ]PfpP` KPTpP1^ 4P=pPԠ oݏ0 >ݏ@)ݏ@)Pխ)ЭP@/ ЭPA׭խ^ԭԭЬݬݏݏ}/ԭ1IP@Qa{֭}׭(֭)׭,6խ1խ,P@Dݬݏ /ԭЭM֭ЬP֬ʷP@Q@ﴷP@路P@Qa ѭ1>'ݏݏ.$ЏPEЬP֬ `Rݭݏ"ݭݏH.P^ ݏݏ.ݬݬPѭ1ݬ ݭO\Uﷶݏݏ-P\ݏ ݏ-m\PbXݏ%ݏk-qP(^ԭԭЬЬݬݏ-ݏ&/-PP~P!ݏDݏ.-ЏP1.ݬ ݬݭWP1ݏVݏE,ݭԭ䔼ЏP1լdZP@[ݭa&PݭݭݏWs,խԭ5u-ݭլ c~HZP@~ݏgb ЭЭ׭֭  խխ1 P`~ݏݏo+  ~ݭݏ+Ь P HխCѭ<ѭTj Џ~Џ~ݏ P֭QPaPݭzԭЏP1%P` P`  P` ׭ѭݭݏݏ+PP`ݭݏ*Э7;#(ѭ&ЭP  ЭP ׭蔽 ֭落ѭ׭ѭ׭葽  ѭݭݏ`*ݭ*$PíPP<ݭݭݏ2*ݭݏVݭ0ԭЏP1BխPP`PPPЭ׬ЬP֬ЭQ֭a`׬լ1~ݏTݏB)~ݏfݏU)խ }׭խ- {^{֭ -׬֬ЬЬP֬,`׬ݭݏqݏg1)ݏݏr)1 խ լ ЬP֬`ЬP֬`ݭݭݏ(ݭP$^ zW；|V~*/ݏPݭݏݏe(o/ݏݏB(ݭݏݏ*((Vݏݏ(ݏݏ'ݬݏݏ'V,K&K%K;c1VVVݏ\ݏ$'Uݏݏo'u1 mPvgP`1ZP@Vf!ݏg6P14 (P1gP`=P@ f-ݏ?"լ UP1ѬPPP4U_`ﮙ9T,$ݏݏau&ݏԩP1x lPufP`%MT@TP@ȋP 1r 3P%>41ݏLݏ, լ NPN1>NP^ݬݏZݏMa.ݏhݏ[ݬvPݬݏiԭլլ1Џ..Nݬݬ́ ݬݬҏPSNԭBMP`~ǂPP`~{P-ﰊ֭ѭԭЬJЭP^2P+`!PݏTP^ݬݏݏvgլbЬP@Cս ݽZ ЭPՠЭPݠC ЭЭPРխ ݭ& խЬP@$^߭ݏݏPPPPЭP1nݏ@ݭ J﷐P@3PР1PQQQQP`Qa\O߭߭PQQQQP`+GP1PQQQQP`ݏ \&PQQQQP`ݏ[[Џ ߭߭[W * PݏЏP1G憐P@"P@ PPԠPQQQQP`P~P1PQQQQP`[?ZP~^P[P[jZPݠqPԠPQQQQP` ֭ѭ PQQQQP`1P#ݏuЏP^ݬPݬݏ-I!HHnPխP1PNݬP}IݭݬJ} ݬݭOPѭPPPﺍ1wԭЏT1ԭݭݏ/ݏ&yխ1{ѭn ѭNSkݏTbP1ݏ;ݏ0,H } |ԭ1gѭb ѭB>ݏTP1ݏIݏ<:ԭ1ѭl ѭL>ݏTP1=ݏ\ݏJsԭ1ѭ\?ݏiݏ]Eݏ\)PWPխ1ԭ1zݏ\(P/Pխ1ԭѭ\1B~(PPݏTݏjխ1]FpF~PFѭ 1ЏЏDF ѭG~(PhPխ1rFE~PQFѭG~'PPխ1!FE~ʖPFݏTPVЬP֬`1ѭݏ\P'PPyݏTpPPc ݏsl P^ԭ2%>E6E PPݏݏխ1O@ݏ ݏ ݏ 8EROJԭEPЏЏPխݭݏ ݏ  ^ݬPѬ  ЏP1ԭxݬ PP`qPHݭݬ PP`5PPPP%ݭݬP PP` PЭPNխ ЏP@֭ PѭP1zݭݬ P PP`P P ЏP^ݬPѬ  ЏPRԭ= PP`P"ݭݬ PP`SPЭP֭ѭ ЏP^ԭԭ"ݭЭP@ݏ5֭ЭP@~PݭݏPݏBݭݏcݏQtݭݬݏd_խ ЏP1~Pխ.ݬݏs_ݬݏЏP1ԭЭP@ݭ ֭ЭP@Qaݭ PݭݭݏѭݭݬDP,ݏݏݏЏݭЭP$^ԭլ ЏP1=ݬ Pݭݬݏ*լԭݭݏݏ #ݬ Pݭݬݏխ ЏP1ѭ ЏP1\֬%1ݬЬP ЏP1ѭԭ9~Pխݏ"ЏP1Mݬݭ խݭݏ:7ݏLݏC019*PЭ@6f̚ݏxݏ[S(ﮚPp(PQ0QQQQQQPЭ`ݏݏy=rܘP0PЭ@W!~ ЏP1aP]~Y P㘭PЭ@eݏݏ1P1&1߭߭ݬ#8P ЏP1ݭݭj:P ЏP1ݬ_ЭP@oq ЏP1խ;~PݬݏЏP1|ݬݭ# ԭЭPЭ@P1[ݬݏWݬөݬRqP ݬѭP1 ݬݏԭ֭ѭ, PpP` PpP`ݬ/ Pѭ"ݭݏݏЏP1ݭݬݏ PpP`ra PqpPQ QbpQa` PSpPQ QDpQС P3pPQ Q$pQ׭ѭ~`PխݬݏЏP1ݬݭh PoPЭ`խp~PխLݬݏ! PoP`# PoP`} PnoP`ЏP>ݬݭԭ PEoPЭ P4oPЭP^լP1ݬݏ= \֬%1ЬPP1ԭR0L9F(wPp(PQ0QQQQQQP`(TPp(PQ0QQQQQQP`*!~P1gP@aP@raխ#ݭݏH ݭ+ԭݏ^ݏS P1 &1߭߭ݬ3P ЏP1_ЭP@\m ЏP1ЭPѭ@l ЏP1ЭP@7ЭP@ݏmn խЭP@rЭP@ݏݏx9 ￥ݬ>mPݭݬݏ ЭP1 P mP`# PlP` PlP` PlPՠ% PlPݠ PlPԠЭa PlPQ QlQa` P|lPQ QmlQС P\lPQ QMlQ֭ѭﴤﬤ 磻P&lP` PlPԠ PlPP^aԭ/ PkP` PkPԠ PkP֭ѭԭ6ЭP@kԭ(Pp(PQQQQP`֭ѭ ֭ѭ@ԭЭP@~^֭ѭ~ԭЭP@jЭP@Nj֭ѭ ^}ݏݏ |U|P@jnC/ЭPՠЭPݠݽN ݽЭPРխ|||Џy7ЏB1 p|PyIP`1N7ݏݏ5 37V&7P@n77P@!l#7P@l6P@k6{ Џ61 {PHP`1ݏݏd1TNP@oݏ_1+P@onݏ<PЏ@MnP@9nݏFҐːP@iݏﭐP@h%P@hP@hxqP@hݏTzh@ݏ$ݏS%2ԭ'ЭP(Qp(QRRRRQa@֭ѭ !ӏP@nÏP@n~Џ3~ݏ% Џy(ݏ\ݏ$e&l4~tyPyP^RPﱼPn?P^ЬP1;Z4ݏ4GP15ݏaݏPR#414ݏbP1E3h13ݏ{P1M3613ݏP1ݏݏzpI3~ZѬ P PPݭ﯅PP4ݭ~(ݬݏ%PP >߭3P1/ݏݏt>>߭c3P1ݏdݏ~>_q>߭33P1 ݏR>3E>߭3P1ݏݏ">>߭2P1sݏ߭2P1\ݏ߭2P1Eݏ߭2P1.ݏ߭{2P1ݏ߭d2P1ݏ߭M2P1ݏ߭62P1ݏ߭2P1ݏ߭2P1ݏ߭1P1ݏ߭1Pwݏ߭1Paݏ߭1PKݏ ߭1P5ݏ߭1P߭p1P ݏ^^c  PP~ݏ /{ Ps Ql Paݏp~ЬP֬`^ݬݏ&+;P`ӏ?ˏѭ  ѭݭݏ8ݭݏM1ӏ?ˏѭ  ѭݭݏ_ݭݏs1ЬP@M;4ݏrЬP@3;ݭݏN1ݏ> (!PP PP~ݏ~PP~ݏݏ ݏ^ݏݏݏ)~~ݏݏ ~~ݏݏFݏ!PխЭ~Џ9~ݏ4ݏ&(Pݏp( Џc~Џi~ݏ^ݏCm Џ~Џ~ݏX(Pݏݏ~ Џ# ЏЏ) Џ~Џ~ݏݭݏݏ&7'ݏ#'ݏݏ( Џh~ЏV~ݏJ'PݏDݏ)ݏ]o'P@#=' Џ~''P@k~͏@'PˏP~'ݏ_S$^Ѭ1#PЭP1qݏݏpl&~.hijP&~fխݏP1PPݏݭjP1Ѭ1߭ݏݏPѬ77լЬP1ݭ 7:PЭP161ݭYPЬP1P1QݭݏP1<6PqԬOݭ6 PXP`P* PXPݠ P|XP`&P ֬ѬِP1 PNXPݠ P?XP`P1P8R=Vݏ0ԭ- PWPݠ PWP`P ֭ѭGP1.PЭP1ЬP1y11iP@z5ݏ1ԭݏ ֭a%P@ݏ&l֭s%P@ݏ>N֭5%P@ݏV0֭;%P@ݏn֭!%P@ݏ֭$P@gݏ֭$P@Iݏ֭$P@+ݏl$P@ݏa$P@ݏdf$P@ݏE֭($P@ݏ.'$P@ݏF #P@ݏ^#P@gݏv#P@Lݏ#P@1ݏv#P@ݏ ݏnUPݏRݏE!ݏ0C! !~Џ6~p! h!~Џ5~T!ݏ#ݏ70!ݏHlݏTԬLЬP@FЬP@9ݬݏV֭SPѭP5Pԭ֬Ѭ 1 *f Џd~Џl~ݏ_3P1u o1[ 51Q 0P&    ѬDݏtݏݏݏݏlϙݏ1 ԭԭ1 Pt1w PlP PlݏW Pp+.ЭP֭`~ݏ0ݏ1 Pp5 Pp4' PpB1 PpO qPW] ޔ֭"~ݏ߭O߭9PfPѭPݏzԭ֭߭ݏd֭약ݏOݭݏ=֭PѭPPѭP Pԭ֭ѭ1h12 Ԭ!\ЭP@DLЬP֬P ݏݭݏ{/\ЭP@Dc/, P ֭ѭ~լ ݏs1 yoyݏPԭO(xPp(PQQQQP`-(xPp(PQQQQP`ݭݏ֭ѭ  ݏ&1 ԬԭVЭP@APFլ ݏHЭP@Oѭ Џ@~ _~ݏZ֭ѭլ ݏen1m6_FCPݏz@** ݏ ݏ6ݏ11ݏ^ݏݏݏ1h1PPݏusPݏpFaP@B-OPݏ Lv3Pݏ:0aP@,PݏT `P@, Џ~Џ~ݏnmvݏbvPݏJvݏs`P@wS Џ ~Џ~ݏpݏ[!kP@]ݏN8ݏm%t Pݏ ݏݏݏݏ1 Џ~Џ~ݏݏH ЏE~ЏK~ݏ1ݏR|DݏbgXЏ*< "P̏@PˏP~ݏh5~ݏl"֭약ݏo s{sݏq ݏ]s Џ~Џ~ݏ Џ+ ЏЏݭݏ&*ݏ ݏݏ! _=ݏ#ݏK1ݏ{1;1G1qp Џ~Џ~Џ~ݏ_%FPݏC%ݏ01d ~Џ,~ Џ(~Џ+~ݏ1$}~~ݏ6%}ݏR Џ~Џ~ݏsPwPݏtf[[PݏX&ݏEݏ2ݏݏݏݏ ^ݏ'ݏ@ݏ< ݏV1 zpݏ,[ݏ [ݏo ݏ1ݏQBЭPРխЏݭЭPݠ!WPݽݏGЭPР խnݏ*ЏPhP(Q#her=["9Ncs}0I|YYP^ ݏXݏ ݏ*JPݏ3o ^ԭլP1aݬݏ6FݬPլЏ=1ѭ(֭ѭ)׭խԭѭ,aխ\,PQPaݏp,,-PQPaݏp- PQPaݏpݭѭ QݏpY PRQKPaݏp ֬ 1֭PѭPo-PQPaݏp-: PQPaݏp ݏp/ѭ/bPPAP ЏP{ЬP֬`15P PIQBPaݏp PPP ЏP P^PݏOP1Pݏ_PݏoqPݏznUPݏR9Pݏ6PݏPݏpPݏP^֬ЬPP\^ܮ֮P]ƮPｮPﶮ`P1ЏEP1P~P]1K ޭ:{P]k~[PP[ЭP֭[`GAP]-P]~ P$B6*Ph""""""""""""ޭﵬ`P0Pѭ 'ѭ1'S~ݏ0ЏNP`bPPV֭ЏNP=R+~ݏPP^լPCլάЏĬլĬլŭP^^4PymݭYP\^1GIP72P^ĭn Џ JPPPPP٪,ѪPPǪP% 浪*1Q/%&^ ЬP׬PѬЭP^^ԭլάլάլլ P1֭ˏPˏQQP9ѬЬЬЭ¬ѬѬ լլլլ PxPPxP^1_aPOJPn31*#ȭṷkݭPRxCߨ PרPϨ+P#P+P-P<P>P@P|~ݏ2lP1!^^hPVIE$N ݏ:P^լ Џ]PKЬ|PЏ:ݭݏ^ݭ1︧ ЏbPЭP^N q(DPzm)$M ݏc:$M ݏ~$P^P!"P\Pצ^Ʀ- ｦ~<ﳦPѭ- PPPe ^? [ _z ЏP1_P@^:eP@9ԭ$ЭP@ЭP@ЭP@֭ѭ՘P@:P@:P@9լPWPxP~Pխ ЏP5PЭ@9PЬ@@9ԭ ЭP@֭ѭP4^PP PԭP`]֭ݬѭPѭݬݏЏP1ݏݬ___\ `&֭&_ݏЏP1ЭP?[ PЭQPP_z ЭP[_ݏ)ЏP1[ԭ,[֭]׭#ЭP֭ЭQ֭a`֭ѭő]_ݏЏP1׭׭葽  ֭蔽֭葽  ߭߭ݭ﹖PխݭPݏЏPIP/n ݏMݏOЏP Э P^Ѭ@Џ`Ï_խѭ ЏP<ЭP@6 ЏP&ЭPѬ@d6 ЏPЭP@N6P^Ь\֬% &ݭݏЏP1ݬPݭݏЏP1% ЬPݏЏP1&%ЬP[ݭݏЏP1%,ЬPЭP] ЭЏ Pr&c߭߭ݬ$Pݭݏ 4ЏP?ݭݭ^Pݏ? ЏPЭЭ P ЏP ^\ݬݏnpޭݬP ЏPaޭ+PXP7PP ЏPPP^߭ݬ2P ЏP5լ ¬ݭݏu߭߭ݬ@P^լ PPPݭݏݏxoЬԭԭԭԭլ ԭ ЭP@ ֭ѭլ׬լBխ:ѭ18֭խ0;ݭݏ: ЭPЭ@ 11խ  ֬{խխ ֭]}!׭խխ ԭ խ5 / )խ$Ьլѭ֭ЭPЭ@ rѭbխ]  Qլѭԭԭѭ9֭խ0:ݭݏ: ЭPЭ@ ֬1խ3ѭ-֭խ0:ݭݏ:U ЭPЭ@ խ~ZP@3^aZݏݏtFZ@Z@33ZݏݏFZݏgP1ZP Q02QС@67YP Q2QС@8YYP@7ݏCCb3CݏݏCݏP1tCP@6CP@6{CPsCQA_@Y_CPWCQA[6@U6CCP;CQA+@%'CPCQA@ CPCQA@ BPP` BPPX BPPЬ zXP@0 P0P`ݏ{ P0P`ݏ%8 807ݏ:+֭ѭ  ݬ~P^ԭԭмммݭݏ֭ ݭݏ${1ԭЭP֭ЭQ֭a`ݭݏ,֭ ݭݏ4r<ЭP֭ЭQ֭a`ݭݏ<A׭u쑽{֭(֭)׭}"׭ЭP֭)`ЭP֭ЭQ֭a`-ݭݏDЭP֭ЭQ֭a`ݭݏL,ЭP֭ЭQ֭a`׭ݭݏT}ݭݏ\iЭЭխ ЏPP^Y߭ݏdPЭP1ѭݏ;ЏP1ݭ  PЭPVݭ,SPNݭ<;9?SPݏP^#TݏZ\}TL?^լ P1ݬPм( PЏOPPJݏ ֭PѭPﶵPP2Լݬݏ׿ЭoݬݏｿPL^ԭѬV1ѬݏĞݏ ݏ 聯Pￗ.﷗ݏ SЏP1P1߭ޭ\%&֭^%&)ݏ ݏݭP5 -P1ѬE Ѭ1痢P P1Z KPݏ P1:іݏ nP1ﱖ EPݏ5 |# Cݭ׻<<P1UPAݭGPPPP<<ݭݏ@ <P1aݏȞѬV Џ ~Џ ~ݏL pPɕ P1ݏݏZjzﬕ-UP zѬ6~6{ {ЏY; .z+{ѬV1<]4]ݏ ݏ Pݏ eykb_Эg[Ѭ6 ݏ 6ݏZw!P1'ݏZwݭr9}9PTݭPےՒݭݏ ?ݏZBwﰒPPP(9D^ݏĞݏ/ ݏ! XPq.iݏ0 ЏP1EP1ݏ@9߭Cݏ ݏS ݏI ^P PvP P]Ѭ9PPPﻑ߭5P߭ݏU Q#88P8 8PH^ѬY ѬX(ݏĞݏ ݏ~ $P="ݏĞݏ ݏ P. ݏ 笠ЏP1-P1#e7ېݏ DƐ߭ؽޭ\%&֭% &1ݏ ݏݭPq iP1Ѭz5PM EP1ݭ淋66P1fݏ ݏ pݏĞݏ ݏ P ؏P1ҏWOPďݭݏ (﨏ݏ 11ݏ ݏxPf ^P1P`ݏ ЏP1v@&P ЏP1UݏĞݏR ݏ6 P P1'ݭݏS Oώݏc 81Ѭz5DP P1ݭ 55P1ݏĞݏ ݏs PX PP1ݭݏ 4ݏ {HTP&PP`}ٍP֍P`͍ݭ->484P1Ѭ7 ѬX4Џ ߭ݏT~lf﫺PWݏ BݭHP-'<Ѭ7 ѬX Џ ~Џ ~ݏ 勤z3t3P)ѬX ѬYPQ3K3P^ PЏ P^լѬ Ѭ Џ PЬP@nP^լ Џ P1ЬѬ,1Ѭ1zѬ'tѬnѬ_dѬ7^ѬTѬ)NѬ+HѬ*BѬ$<Ѭ6Ѭ`,Ѭ0&Ѭ Ѭ!%ݏ mPP 0֭6Ѭf,9ݏ tmPkP0֭ЭP^ԭЬP@aTݬKݏ ﴾ЬP@=ЬP@0ﭬЬP@ ݏ 全ЏP1PPPЮP'Џ Џ Џ T PЏ PP PЏ PP PЏ PP] UPЏ PPܔ4E=+?ݭ1ݭݭݏ 4r4ݭtЬP@P1ԭT~!Ѭo ݏ! {ЏP1ｉ  雷1(5TPP`ݭݏW ЏP1CC\P]TPЭQ֭QP=`60 ѭ1ZT螺PPԭ884  Z׈)Έ8PP`>P]8PЭQ֭QP`ѭTP8ݭP4YS J A1|4.(-.T}ݴP1|!Ѭo ݏ ЏP1PЬQPAΧPЏ Џ 09| |PЏ PP| y|PЏ PP0ݭ0Y4Tݭݭݭݏ 4 1q4ݭP1:|ѬoP ݏ 葉PЬQPAPԭ2ЭP@r4﫳PPЬQPAȦP ֭ѭqЏ Џ 0wѭ8{ {Pu{ m{PЏ PPЏ 09N{ F{PЏ PP6{ .{PЏ PP0ݭ04ݭݭݭݏ 4 @1"PЬQPAPz ݭ﹅ݭݏ 41z1zֲPŲPЏbѭݭZdzeP>8XPЬQPA@P$2z *zPЏPPݭݭݭݏ4@#ݭ݄ݭyݏ41Э︄ԭ>>P]4PPQ{a`֭ѭ4PP`ݭSyݏ$44PխSݭ448P=ЬP@ 4PPݭݭݭݏ)4:1xݏ24 4 Pխ1ݭ44PЬP@Џ5Џ609vx nxPЏ7PP^x VxPЏ8PP04PP-%-.ݭ0ݭݭݭݏ94D1ЬP@w)ѬoݏFbЏP1 ЏwЏx09w wPЏyPPsw kwPЏzPP0ݭ04ݭݭݭݏ{44ݭP4^Џլլ ЏP1$ݬ=P ЏP1 ݏ﹡P ЏP1ԭݬT߭ݬBݭݬDP ݭ1ݏݭ}Paݭg1ZݏݬTP ݬD17ݬݭݏڨݬݏݭSݏݏ ݏݏݏݏݭ%ݬݏݭￕP1ݏݭݭPP`  P` ЭP׭P߭ݭN.ޭPЭQQQQP`ޭPЭQQQQPЏ`֭ѭݭݭݭݭݭݏݭU1-ݏ9﹧ԭլ ݬխ ݭխ ݭmЭPd^ԭԭԭլ t ЏP1ݬPP ЏP1ݏdP ЏP1lԭԭtnԭԭԭխ1ѭ#t1ݏ?ЭP@i&P)ЭP@Qխ ݭԭ֭sխЭP@ݏAx֭խԭԭԭԭԔݭݏݭ︄Pխݭ)ԭԭ111)ݭﾫP~KP1ݭݭm߭ݭխ1;1խ1+խx=nݏQݭPXݏVݭPBݏ[ݭP,ݏaݭPݏfݭPխ ݭԭխխMխխCݏjݏݏխ ݭОԭЏP1/խ1խԭEh#ݭݏ.ﲤݏcݻPhխP~ݭP@P ݏbݏUԭЭܭ׭ԭ1Cg ݏ,խ߭ݭ>߭ݭ+խ1ݭPP1ѭ1խ ѭ1ݭݭݬ$P1խ1ݭ?PP1~ￛP/ݏ tխ ݭIԭЏP1ݭݭﵨ'ݏݏ-Џx1 oPhЭ@W{YpT L~ P2/ݏPﻢխ ݭԭЏP1ЭݭwݭPݭݭP1YխIԭ-ЭP@zЭP@z ЭP@zz֭ѭw֭11 խ ݭݛW8խ3Ѭo Џ~Џ~ݬݏs¡ЏP P<^ԭԭЏԭԭԭԭԭԭԭԭԭԭѬr(nѬo10ݏ2 ݏ#DnP1 uݏ#nP1 8h0ݏݏXPݏ& mP1j yѬSPx xP1@ 1ѬqVa߭ ݏYݏGfPx xP1 ЭBm+Px xP1 1Wm Џ[ЏݏĞ= 5~Џ~ݭzPЭP1 "xKx_Pѭ4x{*PwP`}PwP`wѬq1ԭ{ЭP@wЭP@ﱇXЭP@wIЭP@wЭP@wЭP@zЭP@mЭP@[֭ѭԏ1xխ0w*w wwJѬoݏ爵'ѬS Џ~Џ~ݏЏP1+vݏ  vԭkvݏvP]1VkFݬkvPխ-Ѭo Џ ~Џ ~;vݏڝݭ%vݏ"խ2Ѭo(ѭ̏ ݏ) jЏP1?<ԭ̑u=uuu j ݏQMѬ( խѭ Ѭoխݏ խ1lUMiEHuVP1uݏcМ0uݏﵜѬoѭd\oTiLխ Џ~Џ~tѭ Џ~Џ~ݭݏLPԭ?ЭPЏ@ݬݭPѬo 2iЏP1֭ѭ81ѭԭ11ЭPЭQ@+A%1ЭP@ЭPЭQA@ЭPЭ@ЭP@sЭPЭQAs@sЭPЭ@sЭP@ﳃЭPЭQA@ЭPЭ@֭ѭԭ1L֭PѭP12Ѭo!ѭ1XgЭ̭Ѭo ѭ  ԭPЭP@!ЭP@ЭP@~Џ~ЭP@rݭ~ݏ{֭ѭѬoѭ̭íȭ~ݏMuխpխ r~~ݏ̞խ mr~|~ݏ _ݬP gЏP1ѬoP1o9f(Ѭqݏ CPX1ԭխ~ݏ ]/ԭ1ЭP@女qЭP@}ЭP@qݏ;1bqЭP@]qPqխ1.r\:qݏX٘ݏdPխ1ݏݏZUݏ~|UWЏi U88їPp練&ݏĞݏݏ(sPmVխvpﻝPݏZT1TpԭPPPЮP~2p/Э78ݏZTխ~~ݭݭp+APxr#dd dѭ ֭ѭԭ =121wdnd edѭ 1֭ѭv1As9_ Џ~Џ~Fݏݏؖ&PoЭP׭Pz1#Ѭo>PQPaݏpÄѭЭ'P^tݬ"PP1DP*P1BݮPԮQͮPaPPݏp P6sPl`PʏPPPP^)ݏĞݏNݏ1jPmmem XmP1TmݏO｠ݏ9m@{Pm mP1xmqݏ[Plݭݏb\-ݏh&FP^ЬP1ЬЬЬЬfЬ`Ь|vm1 Ь^1Ь1Ь1Ь 1Ь1Ь1Ь1Ь1Ь1Ь1Ь1Ь1ЬwЬmЬcЬYЬOЬEЬ;ЏP7PW7MXcnB!,P^%ݏݏĞݏ~ݏl\Pcj.[jݏЏP17jP1ݏ/j6ݏqݏcDTݏMfxPi iP}"iC PѭPPP + Џ~Џ~UiݏP^P@ݏЏP1P@]F% NE\ zN/jNݏb@ <M-ݏĞݏݏ kPyh qhPP^ݏĞݏݏ hP9h 1hP1+h\)!h'PݏﴏЏP1hݏ0ݭP%PЭݏ81ݭŔPݏ?ݭ,֭ݏAݏĞݏZݏJiPHg @gP1:gP ЏP1߭ݏĞtPݏ[﯎P1fݏq_3ݏzaPffQݏݏ83ݏ&ￃPfݏ)  PBݏϙ PPݠݭ4fP ^ݏĞݏݏePe.eݏЏP1eP1ݏ ݏePe eP1 &ݏ’Pae\WePBeQ;ea`P `ﮦ߭ ݏݏRRPd!d ЏP1dP1ݭݏݏ8ddP1mݭݏdPjdQcda`P `֥߭ ݏݏ zQPd!d ЏP1dP1ݭݏݏ`ccP1ݭݏ % c/P(cQca` P `߭ ݏ-ݏ#PPGc!?c ЏP1(cP1 ݭݏ8ݏ/>cbDP1ݭݏ9M2@bWPPbQba`82P+ `խP<` P>`P `ݏĞݏOݏ<dP;b 3bP1-brP ЏP1ݏTݏĞdPݏPP1.ݏfhPaaQݏtݏl?.ݏr-~Paݏx0PXݏ֔ PPݠݭ;aPݏ҈ЏP^ݏﲈݏ֭ݏ"֭ݏK֭ݏtqݏdݏW֭PѭP}PP1ԭݏ<"ݏ֭ۡPѭP}PP1ԭݏ֭֭李PѭP}PP1Qԭݏ﬇ݏ֭֭fPѭPH}PP1ԭݏ#k֭֭2PѭP}PP1ԭݏE7֭֭PѭP|PP1ԭݏk֭͠PѭP|PPxԭݏӆ֭֭PѭP||PPEԭݏ֭jPѭPL|PPԭݏ%pP^ԭԭԭլЏo ЏP1ݬݏpP]ЬP֬`P0P ЏP1gP] PЬQ֬aQQP0Pѭ ЏP13:֬1ЏP1P]ЬP֬`P0P ЏP1P] PЬQ֬aQQP0Pѭ< ЏP1:֬sЏP1P]ЬP֬`P0P ЏPwP] PЬQ֬aQQP0Pѭ< ЏPD  ЏP5ŏP*Xݏ ݏݏIP\XѬ*(ݏ ݏݏIPn\(ݏ ݏ ݏIPD\8\1-\1U^PխݏﰃЏP1Gޭܭ߭+ ~dŏP[~dP]1^ѭ)ЭZѭZݏJ^ЏP1Ѭ]2խ Z~ ŏ}Z~P1vPXZ moѬ>LODPխPo(PPPPPJxYPYP1vѬ>XYPPP;P^5ݏݏĞݏݏ&KPsY.kYݏ ЏP1QGYP1GAYݏЏP1(&Y5XvPPYݏĞݏݏfHPX.XݏgЏP1XP1XXﰅ%gPX zXPwݏ܋`XݏŋKXnP"4XݏЏPP^A#9ݏ7ZTP1[6QЏ ߭ݏTݬJPݬݏUݏrݏbފXP(Pp(ݏﺊݏUqݏݏV1JP(Pp( oPxP`oݏsP(Pp(zP1OݏxP(Pp(SPݏ}P(Pp(/PݏݏݬPխ1~ vPlP@%[P@wEP@խ?ݬݭ$PЭ@^P@Nݏ#P@.ԭP@խPPP^ݏݏݏ@[P(ѭݏ|ЏP1)ЭP1"ЭP1   Pݏ|ЏP1w߭߭ݏݏnFP(ѭݏY|ЏP1ЭP1խݏ6|ЏP1ݭ﯁P ЏP1b߭ ݏBݏ6APЭP17ѭݏG{ЏP1bPЭP1Э,* "ku~sPݏbb{ЏP1 qP1ݏ*{P1| uPݏ{ЏP1Xؔ߭ݏݏUP(ѭݏzЏP1ЭP1ݭg Z/P ЏP1eaPЭP1/~rPݏ?zЏP1 Z P1~ݏzP1Y RPݏyЏP15ﵓ߭ݏRݏ7TP(ѭݏSyЏP1ЭP1ݭD~7 P ЏP1B`PЭP1 n P  ݏkyP1h߭ݏݏ@P(ѭݏxЏP1%ЭP1ѭݭݏxЏP1 PݏxЏP1݀ЀʀɀÀﶀﰀ燎ﶀЭ呂ݭ}}P ЏPY^PЭPFݏ EP&ݏ wЏPPk^)I Ax PO11 P ݏOݏ} Џ ԭֱ1O1 PP`ͰP@UݏiNUPݏ vxЏ14ݏĞݏI ݏD QPЭ1RN^P:{- ݏJ OvЏ1 {PP Џt ɰP@mݏfTP w[g R4ￏݏĞsݏu =PЭ1wM {{>ԭ1b1 VP_P`ݏݭuQPݏ| DuЏ1r3ݏĞݏ ݏ PPЭP1TMݏ tЏ14M P:zg}RzPjPPí PPЏ 0ݭ_PP1F =yPP'P` PP`奄Џ߭߭e?a:2ݏ nxݏĞݏ ݏ ;PЭ1 LyLԭ1ݏݏZ0ݏ V0h1ЏC ?0;0ݏݏ!ݏ!NPݭʭݏ !~ѭխݏZ/Э1 ݏ'!rݏZ/ԭ1i PvxiHݏ4!o/1Џ\ X/#Iݏݏd!ݏT!$:Pѭխ/ѭݏe!rԭݏZ.Э1Џ XPѭݏZ.խ1rݏr!}ݏWݏx xݏݏxݏ~!S}Ѭ hѬ  ЏrPЏjPPﴫ_vPխP˫P`/￫ &P1恵ݏ!|H1P)I#I-ݏIݏw Џ!N(ݏ!pЏ!4Џ?P( ݏ!TpЏ!ЏЭP!ݏT~ЭP^VPMH EHP1ѬTݏ!ݏ!{1ѬU^ݏ!ݏ!q{ ЏP157b\P1Rݏ!ݏ!1{%0ԭ1]0ѬT~P@3"P(Pp(PQQQQP`խݭݏ "ݏ"zݭݭݏ"zݭ߭(g1ѬU1JCP(Pp(PQQQQP`խݭݭݏ#"6zݭݏY"ݏ>"zP(Pp(PQQQQP`߭fݏ\ݏ$0P1֭ѭ 1ݭݏy"ݏh"ytݏ"ݏz"yYP@ݏ"ݏ"dyѬT%,#PQAW@QPh^ѬPPPԭݬݏ"ݏ"xݏ"ݏ"xݏ"ݏ"xﻦݏ"ݏ"xݬݏ"xݬXrP:0ЭPQQa`׭խ:֭P`ݭݬݏ"5xЬP.ЬP  ЬP ݬݏ#rխPPPЭP0^ԭ"ݏ=$ݏ<$dݏDPlݏ>$eЏP1pbP Џ'*EݏS$eP1'pFPPPP1e XP1! 1 ݭݏv$ݏn$q1& ԭݭݏ$ݏw$p1 PPPݭݏ$ݏ$pr1 PPPݭݏ$ݏ$p>1 ߭ݏ$ݏ$P9 XPݭYPݭ=P ЏP1ݏ&ݏ&hѭ   ѭ ѭ PPPݭݏ&ݏ&Zhݭݏ&ݏ&Bhݭݏ&ݏ&*h1?6v߭ݏ&ݏ&h4Pѭ"ݏ&\ЏP1  խЭP1ݭݭݏ'g復ݭ﷦5ѭ`+a6PЭP1͏@PˏPP~әݏL0>OЏPb﷙ݏk0"OЏPFѭ#ѭݭݏz0NЏP5PЭP ЭP^hݏ0ݏ0ݏ-J-PЭP+{5PЭPЭLFP ^լ^1Rݏ+a+PBU :UP13P,U $UP1U}RLP1dRfݏv1ݏ^1ݏ,*PT TP1,3PT TP1լKT~ݏ1ŖPݏ1ﲖݏ1ݏS>PxrP1xPPTTET:TمvpP1ݏ1F+Paeݏ +ݏ1P P1?02PS SP1%լISݏ1ڕOݏ1Ǖݏ1ݏS=PP1qS܃P1dݏ1ݏ1լ ~q~լ ЏD*~Џ*~,)P S SP1eV1P P1KRRլCRݏ1߭Nݏ1߭ݏ1ݏS2<PP1P1cݏ1ݏ1ݏL+k(PLR DRP10P6 .P1 Rwx\P RPլIYݏ1!Nݏ1ݏ1ݏSc;Pԃ΃P1whP1ݏPwQ oQP11﹂ﰂP1ݬ 1b߭ݏ2ݏ1PѭЭP1eݭݏ2)Tѭݏ,2JHЏP14ݏݭP$ЭPՠЭPݠMP ЭPРݭݏV2Sݭ戮LM.PЭP1~SMPE =~A0խ(~?P8 L82PK4Bݏf2AGЏP,Pm9'Lz1^ԭ`ݏ2ݏ2,ݏ,%Pd \P1ARP1`ݏ ݏ2ݏ2= P& P1O&Oݏ2gF93P1<-Pݩ թP1N Џ}NЏgP1yݏ1iݏ1Yݏ2Eݏ 3EP1/_ݏj3ݏJ3ݏ5$PN NP1_,P P1M~& P1&_ݏr3ݏq3ݏT/#PM MP1+P P1sM~P1b^ݏ{3ݏz3ݏ,l#PMM EMP1.+P7 /P1!M]WP1]^ݏ3ݏ3ݏ,#P ߧP1,+PL LP1^^^P1k^P1cݏ P1L}TLݏxPD>P1#]ݏ ݏ3ݏ3) P P1W*P P1K}P1]ݏ ݏ3ݏ3P都 P1)P PlyK|PQЏPHP L!^Ѭ ݏ3)Gݏ 4Gլ^&\ݏ+44ݏ`- Pﬥ.拉ݏ,4AЏP1C P19 8[ݏP4Rݏ|-i PN FP1 <P1d [ݏ* ݏo4ݏQ4'P J JP1 U(PI IP1   ۤ?Ҥ_<Ť/Ѭ  ﲤy 磻yݿ׿P1L ݏp4@ЏP15 ݏݏ4P^ VP1 LIݏ4@ЏP1 Ѭ  &Iy IyMGP1 MZݏ ݏ4ݏ4PףѬ 1w£HݏP﨣 P1Y H ݏ4?ЏP19 լTﴊfHݏ5kDݏ5ݏ5ݏS1P9z3zP1ay1H@# Џ@#HvGBPڢG4͢v !vﬢݏ5 ?\vxxPNv<{^ Џ^PePP!v]x>LG1?G$ݏD5>ݏj5>ЏP1Guuu1uuFݏPա ͡P1F ݏ5>ЏP1fw{F@# Џ@#FF2utNu u}AP^Xu)!u5ݏ5= FYw> F1E$ݏ5W=ݏ5J=ЏP1ΠttvtptgtltxvP^tDxvP?t@л^vV︻NhE^+ﯻ#tJE ݏ 6<vP vYSP1WRVݏ ݏ]6ݏ=6PܟVݏ~ʟDݏPﰟ 﨟P1aѬ  D?u D.uﹺP1.Uݏ ݏ6ݏ_6`PIݏ^=3Dݏ P# P1Ѭ  D.s Cs2,P1ݏݏ6Pʞ žP1{Ѭ  Cs CsٹӹP1HѬ 1ݏ6߭?Tݏ ߭ݏ6bPKݏ^?5Cݏ P% P1լT:QCݏ6??ݏ6,ݏ6ݏSe,PttP1}Bq1Tݏ ݏ6ݏ6PrBp~qd \P1NBFBݏ69ЏP1Sݏ6ݏ6ݏ*&P B BP1A1BS߭ ݏ7ݏ6PϜ ǜP1ѭAݏ79ЏP1]R߭ ݏ47ݏ7P{ sP1,Pa YP1OAbp@A?ALp2A=p7p*p4pЭ.pЭ*pGAP1GRݏ77ݏ67ݏXPћ ɛP1P@ @P1hѬ !ArxqP3r\~rxqPrXP1Qݏ ݏ`7ݏ:7CP,ݏ: @ݏP P1?p,&P1ЏP1PBT[xA1e^Pݏc7ݏb7cݏ*&P  P1>P1 CPݏݏ7ݏd72Pϙə P1>;P22ݏ76ЏP1>ݏ*[;ＴﶴP1Oݏ ݏ8ݏ7]PFݏ:0>ݏP  P1S>F@P17ݏYw1'ݏYg1&Oݏ ݏ88ݏ8Pﰘݏ落=ݏqP P1x=cﰳ荒P1ݏY1Nݏ ݏ8ݏ;8AP*ݏ=ݏP P8<+%PЏPPco^ ݏ84 ^nnM߭ݏ9ݏ8PЭP1znn-snP1T>|ݏ93ЏP1+֭>> ֭"n֭  -> Џ9~Џ(9~ݏ9-3ЏP1>(ݭPݭݏ092ЏP1m|PPPmݭݏ0qlhomݏT9ݏE9r>\mݏd9ݏU9W>=mݏt9ݏe9<>(mݏu9%>P^lllll,lм蕽P15ЏЏݭ7P/P`}!>Э |Э׭խխխݭ|PЭP1:lЏѭЭѭѭ Э lP`>PP`>kPPkP֭䑽  -> Џ9~Џ9~ݏ90ЏP1>(ݭPݭݏ90ЏP1ݭݏ0WoPP׭ѭ  ЭPݭGPЭ\j|kݏ9ݏ9<jݏ9ݏ9;jݏ9ݏ9;jݏ9;ݭݏ9;PL^yjwjujլЬP1E ѬbIݏ:ݏ:ݏ-*P(ѭݏ:e/ЏP1 ЭP1 ݭr1 ЬP1 I߭ݏ7:ݏ!: PЭP1 ߭PЭP1 ݭݭݏ8::ޭݭݏ@::ݏJ:ݭݭݏC PMiԭ1* H߭ݏl:ݏK:{ P(ѭݏm:n.ЏP1 ЭP1 ߭PЭP1 hݏEݭ PhP1 G߭ݏ:ݏ:PЭP1 ߭PЭP1q 7hvݏ:ݏ:ݭݏDP@hP1 PЭP1 ݏ:ݏ:ݏ:ݏHPgԭ1 7h1>PЭP1 wݏ:*-ЏP1 Gݏݏ:ݏ:PЭP1 ݏPЭP1r |gm2PPЭP1U cNgHg1& Fݏݏ;ݏ:tPЭP1 ݏPЭP1f1P(ѭݏ;4,ЏP1ЭP1kff1E߭ݏ0;ݏ(;PЭP1xݭv1P~$Pݏ1;+ЏP1Fݭݭ1E߭ݏR;ݏI;PЭP1ݭ1P~#PݏS;P+ЏP1ݭݭ0E߭ݏ;ݏk; PѭЭP1߭PЭP1ݭ0P~#Pݏ;*ЏP1Uݭݭ 0ݭݭݭݏIP3eխ ݭh$ԭխ ݭV$ԭխ ݭD$ԭԭ1DPЭP1ݏ;ݏ;ݏ;ݏILPdԭ1eb)bݏ;)ЏP1Џ;dЏ;dC߭߭ݏ;ݏ;P(ѭݏ;)ЏP1,ЭP1%ݭHt.pYC߭ݏ/<ݏ<KPЭP1߭PЭP1ݭݏ .ݏ .P^ݏ0<)ЏP1Џ_bscXsuc3cbԭ1CB߭ݏk<ݏI<PЭP1/߭=PЭP1ݏm<ݏl<ݭݏUPbP18B߭ݏ<ݏn<*PЭP1ݭ-Pݏ<(ЏP1߭PЭP1ݏTݭuPrbP1NA߭ݏ<ݏ<PЭP1:߭HPЭP1#ݏ<ݏ<ݭݏWPbP1NPЭP1ݏ<ݏ<ݏ<ݏAVPaԭ1Aݏ<ݏ<=ݏt*PЭP1߭ݏ<ݏ<PЭP1b߭pPЭP1K﬊ЏQ﹵ﷵﭱݭ߭ݏ<ݏVP aP1߭ݏ<ݏ<|PЭP1ݭx+@߭ݏ=ݏ<PЭP1߭PЭP1ݭxݏ=ݏVPp`P1L?߭ݏ==ݏ!=P(ѭݏ>=%ЏP1ЭP1ݏݭͷ+J?߭ݏ=ݏ]=|P(ѭݏ=/%ЏP1ЭP1 PЭP1h_留ݏ=ݭͷݏK Pz_P1V>߭ݏ=ݏ=P(ѭݏ=$ЏP1%ЭP1ݏݭͷ*T>߭ݏ>ݏ=P(ѭݏ>9$ЏP1ЭP1PЭP1r^ﱌݏ.>ݭͷݏRP^PaPЭPcEnݏ/>#ЏPGPmRTUJG]ЭP^ݏF>I#P5~ݬݏd>.ݏl>ݏk>ݬ~=PP^<ݏ>ݏm>Oݏh.Pk cP1Y1߭PC+ ;+P1լݏ>"ЏP1ЭZЭZЭZЭZЭZЭZЭZЭZЭZЭZЭZЭZЭZЭZЭZЭZ*P17 1Pj* b*P1\PPPYլBݏ>Y Џ>~Џ>~ݏ>ݏSP\\P1A;P1A;ݏ>ݏ>ݏXP) )P1eP) )P1KP1լBݏ>) Џ>~Џ>~ݏ>ݏSPj[d[P1N) YYX1լBݏ>*) Џ>~Џ>~ݏ>ݏSP [[P1(XXX1|լBݏ>( Џ>~Џ>~ݏ>ݏS9PZZP1:(AX;X2X1լBݏ>j( Џ>~Џ>~ݏ>ݏSPJZDZP1.(WWW1լBݏ> ( Џ>~Џ>~ݏ>ݏSyPYYP1z'WWW1\լBݏ>' Џ>~Џ>~ݏ>ݏSPYYP1n'AW;W2W1լBݏ>J' Џ>~Џ>~ݏ>ݏSP*Y$YP1'VVV1լAݏ>& Џ>~Џ>~ݏ>ݏSYPXXP[&VVV>ݏ>ЏP-PhH(P^7ݏ?ݏ?Sݏ.>P# P1P1~[7ݏ ݏ?ݏ?P%ݏ^%%ݏ[1H7ݏ?ݏ?ݏ$/P% %P1P}% u%P1﷛Ph%@P16ݏ?ݏ?ݏFg ЏF~ЏF~ݏfFD ЏF~ЏF~ݏF! ЏF~ЏF~ݏF  ЏF~ЏG~ݏFP1^ݬFBݏGoIݏGݏGTJݏ"GݏG9Jݏ+Gݏ#GJ~ݏ4Gݏ,GJ~ݏ=Gݏ5GJ~ݏFGݏ>GIݏOGݏGGIݏXGݏPGIݏaGݏYGyIݏjGݏbG^tIݏsGݏkGCIݏ|GݏtG(zIݏGݏ}G GIݏGݏG8IݏGݏGyHݏGݏGݏGݏG^ݬݬݏGP PˏP~ݏGݏG^0HݏGݏGC-HݏGݏG(H~ݏGݏG H~ݏGݏGH~ݏGݏGGݏGݏGGݏGݏGGݏHݏGqGݏHݏHhЬP~ݏHݏHKaGݏ HݏH0^Gݏ)Hݏ!HAGP`~ݏ2Hݏ*H^Gݏ;Hݏ3H+GݏDHݏPIx[tM^>>P1PݭݏJݏJ3ѭP1ÁPݭݏ#JݏJխP1oˏP1dg^ UP1DH@7ݏ$J \ݏ3J I=m=PTݏ@J %MݏHJ 8ݏNJ #ݏ_J PݏfJ ݏkJ;;ݏxJ:ݏ~J;t:W q=P PPPj;PďdP:PݏJݭO:(ݏJ ݏJ ݏJ:ݏJ%:ݏJ9ݏJK:;ݏJp;iݏJ9I) ؐݏK9ݏK8ЭP18 Џ+K~ЏEK~;P1}Y8 ЏYK~ЏrK~};P1BݏKqq:V)P1ЏP1 P1Py?zz??zz??zz?1^9:1:&7 Ѭ19Ѭ 9pլk:9;ݏK ݏK ݏK ݏ%L ݏFL ݏGL n^}}}}}}ݏIL{͍ݏJL {﵍ ݏTLzݏrz ݏ`Lzݏ.{N 6.6ݏeLݏrݏrz ݏwLnz88U08P<ݏLz;ݏLz,ݏLzݏLzP ݏLpz{ ݏLZzݏLMzg|m|@^Q|d5{1FuPK F6P96PP. 7}Џ̕E41W4cǏd4PPPPPѭ̏dЏdЏdѭ̏d6555P,5PPխǭЭPPPȕ խ5ѭ̏ ݭݭݭݭ ݏL߭ݭݭݭ ݏM߭߭kxzuzPPaЭzǏPzPԭ;zPzPMݏ$Mxxz.wz֭ѭT^Ѭ 9Ѭ 3y5(1@E5y5 21_5 R51KݬPЬP1ݏPݬݏr]y1ݏPݬݏ=11ݏPݬݏr!1P1ݏZ>yyN ݏ%M]wݏ&MPwvyxݏZvYy1y OyIyN ݏ,M wݏ-Mv"y1ByyN ݏ:Mvݏ;Mvx1  xxN ݏJMvݏKM"vx1ݏVMxvݏWMuݬavx1ݏ_MKvݏ`Muݬ4vZx1zݏjMvݏkMuݬv-x1M #xxN ݏuMuݏvMuw1ݏMuw1P"(UԑY1D A1wPwPMݏM[uwZ v1~t1nX,JPCQ<PaݏpݏMt1?ݏMt?6tݬtv1ݏMtݬtv1vvMݏMtЭvݬt1ݏMctݬsЭ}v1rvlvMݏM,tЭPvݬtgݬ ݬݏM߭߭sv?=;ݏMsv&P %(A8 ,c^ݬݏM1ݬ #ݬݏM^0iBw0{l0LJ^0{S0,ݏNݏM"F.0{ { {Q\ЏNAݭbYPխ5 PbP`QaݏNݭ/P I/4:ݏX):/q?^ݬݏ*NݏNݬݏ7Nݏ+NѬȬ /-ݬݏMNݏ8NL.\zݬ^ݏ\ݏ$_^.i9PPPesm.PPPMs?s$?sP.PPP'ss^).P1#$s'ݏAPss -P1լЏNNլ ЏUN ݬkPdЏ\Nݬ PePPЏnN rЬP1tѬ'Ѭ~ݬ ݬݏNݭ 1Ѭ  Ѭ&@PPP~ݬ ݬݏNݭ1Ѭ/Ѭ%@PPP~ݬ ݬݏNݭNѬ+Ѭ!PP~ݬ ݬݏNݭfݬݬ ݬݏNݭKq|P,1ݬݏNݭvq{P[,1Uݬ ݏNݭݏN{P,,1&ݬݬ ݏNݭq{P+1ݬ{P+1ݬݬݏNݭpp={P+1ݬ ݬݏNݭ>p {P}+xݬݬ ݬݏNݭ dpzPI+DݬݏNݭ6pzP+P7iP^ݬݏOP^ݬAP^լЏOլЏOݬݬݏO2 ݏOl ^ЏO*ЏO*/e*((ݏOd)ݏOݏO(((P-3)(()1(((ݏOqk(P`=P1Z(P`-6N(P~eP~ P1RݏO( (1m&dݏOݏOw)=dcn)(~ ݏO ݏ P1z)1csBcr5cv(} ݏ%P ݏ>P1mlcr_cv1)PPF(oP(Y} ݏWP- ݏvP>1ЏP(9({P(} ݏP ݏP1bvD'<(4)P'| ݏP ݏQonbs'abvTbr Gbx$'Q'O' C''~'.'bP^%%ݭݏ2Q1~ݏHQݏ>QP17%%P{%u% h%P`-({ ݏIQ ݏbQ14%&1iЭP(u{ ݏ{QI ݏQZ1L$$P$$ $P`-(${ ݏQ ݏQ 1 $Pѭ Эc%(z ݏQ ݏQ1 1 S%1 $1 %1z "Џ^"Џ""@# Џ@#"#.19 16 `(Cz ݏQ ݏ R(1 Џx_1 _(z ݏR ݏ3R1 ݏIRݏHRݏGRݏFP_1 _(y ݏJR ݏ^R1 ЏvS_1a J_(ny ݏrRB ݏRS1E =$Џv_1 _()y ݏR ݏR1 ЭP(x ݏR ݏR1 #ԭn"e"w`"Z"P`-ݏSH"PS֭F0"uP"("P"jP"!!!P!r"-խ(x ݏ S ݏS1 ѭ(w ݏ*S ݏ;S1 ѭ0"(w ݏLS ݏwS1 !ݏSݏSݭݏSݏS!<#P(Dw ݏS ݏS)1 ""ݏTݏTF!ݏT Џs\1 \(v ݏT ݏ%T1 ЭP(v ݏ9Tl ݏ\T}1o   P   P`-(Hv ݏT ݏT-1 !Џr[1R!1L!1ND  u 1ݏOЭP(u ݏT ݏT1?=P60 #P`-(ou ݏTC ݏUT1F 1$1ЭP(&u ݏU ݏ>U 1P(t ݏaU ݏxU11FЭP(t ݏU{ ݏU1~&$P P`-(Vt ݏU* ݏV;1-ݏXmݏ/VݏXPPPP<lpyݏݏX:/P(s ݏ8V ݏJV1ݏiVݏ\V;tIP1gЭP(ss ݏjVG ݏVX1JP P`-("s ݏV ݏV1 P ݭEPHP$(r ݏV ݏV11ЭP(r ݏV` ݏWq1c  P P`-(;r ݏ8W ݏKW 1߭ ݏĩMPխ(q ݏ^W ݏqW12ѭPPPݭ[1ЭP(q ݏWe ݏWv1hP P`-(@q ݏW ݏW%1Pѭ 4ѭ;*Э-'ѭ^ Џ^ (p ݏW ݏX11ЭP(p ݏXm ݏ6X~1pP  P`-(Hp ݏPX ݏkX-1Pѭ ЭSѭ(o ݏX ݏX111~111Џ鹿Џ1lЭP(xo ݏXL ݏX]1OP P`-('o ݏX ݏX 1P`P:LXDPn ݏ Y ݏY1Pe1t1V:$1E*$16ЭP(Bn ݏ*Y ݏDY'1P P`-(m ݏ^Y ݏoY111ݏY^1P8B3 SPe"( mSoD1Y֭䐽1P^ݬݏkݏkЬqЬP1\ ݏk}0P1m;ЬP1f;Ѭݏk'[9\P@5O(\P@$OQv2PxѬT ѬU1ݏTݏkݏkݬݏlݏkhqݏlݏl{ݬlPݭݏ-lݏlU'qݏAlݏ.l:ЭP1M:Ѭ5$Ѭ6ѬEѬ Ѭg ݬ1:ѬQ$ P P19=S19լzbݏBlЏP19Pm eP19ݏplݏolݏnlݏLP74DP1i9ѬkE^PЭP1K9_PXQQPaݏpP19Ѭ1v ݏlݏql|ݏg﮹P P18P P18v uCPPf[:SFP`=7"o}6#ӏ   Џvӏ@myMq>ս ݽЭPՠЭPݠЭPР ݭЭխ,mvpPPPX17Ѭ*3ݏݏlݏlP1 )P1g7P1b7Ѭ1UݏlݏlݏkP*SGPX17P17P P16GPW16ѬaPW16Ѭ\PW16Ѭ1ݏlݏlzݏPh6P+%ݏlmЏP1I6 P1766P P16PPPPVVP15Ѭ;Ѭ9 ݬ15Ѭh1ݏݏ(mݏ mﭲPZ RP15PPխЏ)mݭݏ*mw ݭݏ5PPP*V155Ѭ$Ѭ7ѬYѬX Ѭz ݬ14ѬG1ݏݏ9mݏ.m P.ݏ:mЏP14eP14ݏ4[ݏS| PA 9P1s4rP' P1Y41k ~/PݏPmN UUP1$4U UP14ѬS'Ѭ(!ѬrѬq Ѭo1ݬF4PݏpmݏamѬ( ѬS>^6:.2)tTCP& OTITP1S3Ѭ5TTP1"3B13Ѭ ?13Ѭ< -D12Ѭ@ Ѭ 1BѬ@ ЏqmPЏmPPݏmxzݏjaPV.NݏmЏP1r2*P1h2dݏmݏmݏj P.ݏm>ЏP12P12Ѭ  Ph hP11h_ZRRP11qo?11ѬC1R+P> 6P1t1_RYRP1c1 RRP[P``ݏݏnݏm>P P1!1 P P11QQP10 QPP`>ݏݏ)nݏnʭPw oP10mS10ЏP10Ѭ21Wwݏ*nЏP1k0'V P QG?Qa= P= P Q?Q2=twݏEnݏ?nZwݏ=P.ݏFnЏP1/fP1/ݏݏonݏ\nP@ 8P1r/ aPPjPݠ  P4P.PPP13/Ѭ Ѭ Ѭ_1/ݏݏnѬ  Ѭ Џpn~Џn~P P1.hP|Ѭ pݏn1ѬPݏn1KOEOP1O. &ݏnJݏp4ݏnPN1-P1-ѬD R1-Ѭ1Vݏݏnݏn﹪Pf ^P1- mNgNP1q-/ݏn@GgP ݏnP11P`\\PP`n*N#bBlL\xPqP\`|[PXKQa`A?P86)P`1QP.P`#ݏn PPP PPݏnݏnݏݏGPLLP1+yPPogݏnxRPpLjLP1t+ѬѬ> Ѭ] ݬH1Q+Ѭ1 Dݏݏݏoݏo5P.ݏoЏP1*P1*ݏ3oЏP1*DЏKouݏݏ|oݏLoPG ?P1}*|P- %P1c*;~tPPPP0K1;*Ѭ384P P1* ~JJP1)Ѭ Ѭ 1ݏ ݏoݏ}oP$ j fP1)PT LP1)3PeJ_JP1i)ݏѬOT8ݏoQЏP1-),P P1)3aP1(Ѭ sݏoЏP1(ұP {P1(ݏoݏoݏoݏFܼPM J3P1(ѬH <1k(Ѭ Ѭn Ѭ1:ݏoMЏP1)(%ݏݏJpݏpP  P1'aPݬ?RPxrP1'ѬVݬ PH1'Ѭ18ݏbݏ\pݏKpeݏ8[vP ݏppݏap 1ݏbPݏpݏqpvPN1*w*n.e }\QݏpЏ] ~@ŏP[~, 6P1tE???P1I P'?12Ѭ1mЏ}r (ݏݏrݏ~rP&ݏݏgsݏrćPr e%SݏQR=P1{g?*2ݏhsrRݏQRЏP13 P%RݏEQoRP1 PP P`/ sP1} ݏsvRZQP@:-ݏ,ݏQЏs ݏsRЏP1. kPPݏs$ЏP1 ݏsvHP1Ѭݏ t﻽ЏP1ݏ^tݏAta^ݏݏݏݏxݏ{x/~PԾ9̾"ݏx ЏP11P1_PX@(2 PPݏxﰳnЏP1~Pw9Q2a`~P@j(ݏx'Tݏx߸P[ݭҸP[[[%ݭݏx ݏxݏx ݏx1Џp;ЏyCJs_ѬmB DP1yѬU_ݏyxЏP1TSP P1:xUP1Ѭ1 ݏJyݏCyNݏbﮐPݏQyЏP1y qP1gP]WݏvyЏP1w3P1mѬ1`ݏyݏy.QݏcPݏy8ЏP1̻ ĻP1︻MP﮻層ݏyЏP1P1Ѭ1ݏݏyݏyP ЏP1l/f/P1pJ/D/P1N+PcPݏzݏy~)º..P1 Ѭ Nݏzݏz TݏhP{ sP1 in1 Ѭ!1ݏݏNzݏ z#P0* ЏOz  P1F EP P1, a,չݏPzＳ_a--P1 Ѭ"+ѕP zP1 >P-1 Ѭ1 Ѭ01ݏ ݏgzݏVz5tP2 *P1d `ݏݏzzݏizOP P12 FP޸ָݏ{zѬ1 h18BݏzݏzﾹXBP(Pp(ݏzݏU=voQBݏzݏzd6B1*BP(Pp( O,PXP`oݏzAP(Pp(ZP1OݏzAP(Pp(3PݏzAP(Pp(PאַAݏzݏzsPPP+1 ѬN,PL DP1~ ݏzP1l Ѭ$1GݏzgЏP1C Џݏݏݏ{wݏݏݏ5{ݏ{%vP禮.ݏ6{ЏP1 zP1 lݏP{﹫ЏP1 Ug P6 .P1h @yWPF*1Q Ѭ%1 Dݏݏݏ{ݏ}{5uPڵ.ҵݏ{ЏP1﮵P1卑ݏ{ЏP1D﹑Pn fP1$q)k)P1u >Gݏ{@=~+P1)1<Ѭ&1/ݏݏݏ{ݏ{ tPŴ.ｴݏ{ЏP1P1ݏ |ܩЏP1x/蘿PY QP1aݏ#|ZL9PR(1]Ѭ41SP P1:*(ݏ(|AԭNЭP@խ7ݭݏ;| ЭPݠݽݏE|ЭPРխ֭ѭ'P1Ѭ?1ﻏPp hP1V\BݏN|3#ݏf| ݏs|g ݏx|Xݏ''P1 Ѭ'1ݏݏ|ݏz|Pﳲ 﫲P1ݏ|:PRխ7ݭuP)wݭݏ|asZy&s&P1}ѬAѬa Ѭ1Xݏ|ݏ|HݏpgP$ ݏ|.̱P1 ݏݏ|ݏ|P鈴 P1>P|P1u1k1a1W1 M1@?ݏ|ݏ $ݏ|kA%+ݏ|ݏӗ ݏ|8 %%P1 ЏP1PEOYcwmw並^2PPѬAa/}s/Pa[ ݏ|逸Џ?ݏ|,PPPP$1[Ѭs ѬtCFP P1-ѬsPPPo$#P1Ѭv1ݏݏ|ݏ|lP P1<ﱋPb ZP1ݏjP<6PPPZ#1eѬw1Tݏݏ"}ݏ}/lP P1&Pî ﻮP1&PPPP"1Ѭ{8P8 8P1""P1Ѭ}cPd"1oѬ~1^ݏݏN}ݏ#}M~P P10ݏO}裡ݭݏ@7PQQQQP`@\PQ4Oz!P1o!i!PtѬIiP:7 27PQݏݏW}K!!P!ݬݏi}ݏ[}ЏP^ebdb Nb1EbP14b1[ #b{P\K`Db_4f,$ݏ&ݏGza"/a a1G/a a1"?ka \a1 LaGX'```P`P`)`a1\<`,~ݏ6ݏ'B`w`P`PgO`ĺ@W`PPS`/G`P@`P`0`P)`P`P'7hP^ˏ߭.`^ݏMݏ7qݏ>^ݏkݏN@ݏ>WP'ݏ&_=ݏݏl^آݬݏݏĪ߭=_ﶟݭݏݏˏP1k^]ݏfvY Ov% Џ~Џ~ݏJh-ݏ7ݏ`*ݏj^ݏӇݏćĩ1!-ݏݏԇD,ݏݏ}ݏ|]l]~~]Q]eݏ2ݏ]!].ݏ2]z]r]Q]S]ЧH]ﭧ裏ݏfP"3 ݏL'ﮔ^ԭ\\\P\D\ЭP^'P `\\ }\Ip\ݏݏ]\O\`PF\æ3\ЭPP^)\ݏ+ݏ\1\[mݏGݏ,`Pݭݏ[ݏH;խЭP1P`[}P=[PѭP s[ܥݭdPN[H[ݏjݏ\ﳦ![P`PˏP [ЭP^ ԭ1PﵥP 贈 ЏZ(PsP/ݏwݏkЏPLЭP׭P1hխ ЏP*YZ P`PʏP,^ԭYݏݏxsPݏݏ$=2'YY~YխF߭|YPiYzЏWYMݏݏﴤ.YݏψݏYݏݏЈ~'Pխ1XݏݏGXݏݏ,$ݏDѭ ݏ4ݏp|QuݭݏSݏK｣)ݭ琉PЭP֭`~X1PP_1~?PխW~?Pխ1ԭխí~&v&׭խ ѭ1xP8խ Џs~Џz~xP8ݏTﰛPVݏ異Bխ0O~ݏ~ݏ߭U߭%~~ݏ|VﲟoV~LVVݏݏjVݏЉݏݏ_VLJV.ݏ2BV/-V)V$ݏݏщ2/ѭ U1ѭ U1UȏU~JPU1-U1U%/ 1խ1Uݏﺠ3ݏ|$UT~ UTݏݏ_TݏݏDݏT﫝T.ݏ2TTTuDL4PPѭ )W!ݭ ~| ݭj ~[1^ԭSݏ,ݏcTAݏ-p1  7ݏMH1 S7ݏhPiSݏn1 QSΝRSDS7ݏ)P.Sݏے1G SS%S&ݏPSݏϊ1 R&ݏ＊PRݏn1 R~xvR1CݏIݏ6tRݏ[ݏJߝIRݏmݏ\ĝݏݏn艹#Pݭݏݏy1ݏXݏW7 3~"~ݏݏXP@ݏXݏQQݏXݏ1 8Qn1sݏXݏ̋h[ݏ݋ΐhd Џ~NP@~?͏@4PˏP~ݏzݏ!mݏX` ݏQ[8ݏhݏ6 ЏÌ~Џʌ~ݏ ݏόݏpK~ PݏЏ1<ݏݏ~/ݏ.ݏcݏIݏ/HP1ݭݏWݏJy ~~ݏݏXP)ݏXݏX=O0O51MhRSP\ ݏoﳎ1NݏݏaNPPPNwNNNݏݏPtNnNݏ΍ݏkN ^NoЏLNJN =NoЏ+NMݏĊP1ݏύ%ݏݏߍdMFPKP/ݏ￉ݏݏqMkMP%d Џ~ЏG~ݏ ݏY,M1\ﵗݏlݏ[1/L{LݏL'lLLוLBnЏLLݏݏmݏf1P1]SLݖזݏݏޗ1!Ldݏݏ７LPK` KݏЎݏ1ݭݏݏюq,ￖﳖPﬖ`PʏPPݭݏݏ+ѭ9ݏݏ15]KK1#J+PP#K ЭP@ЭP@K1P`JqiˏPP`WݭݏݏnﾕﲕP𥉉`PʏPˏP~1jЭtNӏ#mJʥPRJ!JJ殮Pq/Jѭ"JѭJ0PPѭ KЏo ѭ- FP; ЭЭ~P~P\Rbݭ~P ~pB"Э ѭ  ~ݏS%II1頻ݏOݏ3ݏjݏPph ^ݏݏkBЏ5 vH ﲢhHSH"KH)XPI/H!HN-V% Џ~Џ~ݏￇ) ݏ慎GNGݏݏ7GݏǏݏGiЏGGhЏtGЭP^ݏr4 Џ~Џ~SݏFݏ؆eݏ,ؑ̑Pő`PʏPˏPѭ\ ݏ PЭP^~ݏ'ݏ!PP~ΡP~1P]~ԌPP1#Fݏ(Z1w(1m:1cEEݏ+)1FEEEݏ91"ݏX: ЏN~ЏQ~ݏ<E Eξ(ƾݏYE߉uE ݏeE%~~P~~ݏf)EE=KPKݏeݏVݏuGݏf8ݏW)PPePmPoPs Џǒ~Џ͒~ݏtDшgD"ݏԒsݏh綠o1tP1~dP~)1F { 1'u;$ݏw6~Pݏ\C 11\1Џ$P`ՍP΍`(P`PʏP0#QQP  Џ$yݏ.|Pխ~6P~11 1Pxk########################### #############################################################k#################1.1&^mP5 B=71~ P ݏݏ^NݏȭݏבֿݏԃP^Nݏ߭ݏɭqݏP^ݬݏݏ;ݬ^AMݬݏ7~ݬ֬^WpP~ݏݏוֹL  ~  ЬP֬`^ݬ1PݬݏEݬݏ1ݬíP+P`ݭݬ~HPP ׭խP^ݏ=ݏȊ_[flPݏeݏ>^KH#> ݭwPݬݏf{~ݬݏi~Ь^AK   ~v  g^ԭݏ[qP߭üխPݏ ݭԭ)P@mЭPQAY@S֭ѭ ЭJݏpPݏRݏǮpPݏē6ݏӮpPݏ̓ݏpPݏ̓ԭݏzpP߭խPݏݭ9ԭ)P@@ЭPQA@@z@֭ѭЭe@J1kݏ JP1Jݏݏ̓MIݏݏ2Iݏݏē?VtP?ݏ??WtP?ݏ ?s?1ݏ >IPRݏ 6PP8Iݏݏ̓jHݏݏēO6Hݏ ݏ̓2Hݏ"ݏēݏ%nPݏݏ0znPݏܓ߹ݏ:^nPݏؓùݏDBnPݏԓ粒^ЬHݬݏ_ݏNڅ Џm~Џr~ݏ`z}G@ݏݏy@rP洞ݏKz%HP1@#Hݏ+z= H'B Џկ~Џ~ݏy ݏyPp FFݏݏ1ݏyݏݏ]ﻄPp  F1~`ݏ2ݏ'"|`st`kݏ79y_`@PW]/PQ Paݏp~Ng֭ݏ:x Џ<~ЏQ~xݏhx_ _~Џo~ݏjRE ЏcE~ݏpdxݏݏnEQݏ7xݏݏJPp z +EPH_ _q__ ^q^^ ^q^D ЏbDP,^ԭiFP1ݏǰݏӏ%D1VD DݏݏXP1ݏȰvݏXݏvD] ]p]] ]p]] ]rp]eP1ZDC  ݏC H2D?$D%D'C)mPic[ݏ vC&ݏ$uP1@$1XC C C PРխЏO\mҀPݠݭ4E,P\\EbB/\&\ Џy~Џ~ݏQAu_\Y\e\ݏݏJ\P1Pu Џc [ݏ߭}yPݠ߭]n+P[[ݏݏ\1kBA  1A 1A AP ~PРPPխ@ݭyP2\Pݠݭݏ@PݠݭݏݏӱPՠ UPݠ lyP@~Pݠ ݏy |T~Pݠ bTݏ%ݏ=@ -7Tݏ=ݏ&ݏ]@ 1ԭ.@^@B~Pݠ@72~!~Pݠ~PݠLw ݏ>rMH@}Pݠ2@C(}}Pݠ}PݠP}ݏݏw*~խr}jݏݏ~m}Pݭݏݏ}խ'ݏrݏ޲qݏ'qխԭ>zխ>ݏOq\1?|Pݠ?87|!|Pݠ|PݠT ݏ_qM>{|Pݠ>(k|U|PݠK|PݠXխ)C|!6|Pխ ݏȳpԭ== hW_V>{Pݠ@>A7 {!{Pݠ{Pݠ@ ݏhp1o=f= \ݩS=h{Pݠ=,ӏ@T{>{Pݠ4{PݠDd=\= {Pݠs=l7zPՠH+zPHzPݠzPݠH3խAz9zPխ%|< Џ[~Џ_~ݏ$Moӏ|z1]_< =P1$<\~ݏb߭sݏn߭sP߭O zPݠ O1;ݏt߭Wsl'P C = 71 +PPePmPoPsϚ~ݭݏ~߭rgyPݠ߭ayTyP0P,I,,,,,,,,,,,,,,,,,,I:1: Џ:"Y; Q;P xPРPP): 2; *;P xPРPPխ,'xPݠ0ݭx }xax1: :P LxPР\PPխЏ蕽)+xPݠ0ݭ%x x ݏl;xM.xݏݏԴox169 1Џխ,'wPݠ0ݭw wwPՠ$1vwP$jwPݠ0`wPݠ$ݏhEoP}w L0wPՠ(*$wP(wPݠ(ݏ,PL/wo]R"ݏcPR 8P1vx8 o8 8~ vPР8~ݏyRopvPݠ0bRgvZvPխ ݏkD8 <8P vPР,PPݭ|pP[RvlpP[[jݏ(jQ Q{dQQ Q`dQQ QEdQP1uݭsQndQݏOuSuPݠ0EQ776)aP0u*u"uݏWiCuJ6uݏvݏhwu7P,qm> ݏwf P PݏzPn/7ݏݏ{u@1`t1 7) ;t/67616 1WtP1PխBѭЏOݭPխ5 Oj1bխ]5O O>bO~O vO#biOgO _ObROP1h>Pխ+ 2OkЭP׭P11|Џ1 5PPѭ1֭NP`NP`~/r1a5Nѭ1NP` PNP` 1uNP` PbNP` zK 5BINP` P6NP` *NP` PNP` / NP` MP`  ѭ1֭MP`ݭMݏZrݏOMݏ6lݏ6lP ЭP׭6ЭP6! ѭpq)0SqG3 5631 >q1:ݏMHP131| Џt6P[[֭LP[`LP`~;LP` PLP` LP` PLP`  ѭL4291 iVPѭ ݏ e1>ݏ͵&LOP  L1ݏѵL.P$K1ݏյKj1ݏٵKP1AݏݵKPݏKi11ݏ|KPݏeKi S11ݏHKqPݏ1Kni11ݏK=PݏJ:i01gݏ)J Pݏ,Ji013ݏ:JPݏ=Jh01ݏKxJPݏNaJhO01ݏhDJmPݏk-Jjh01ݏJ9PݏI6h/dݏIPݏIh/1ݏIPݏIg/I1ݏ϶oIP#ݏӶXIgF/OIMݏ5I^P#ݏI[g /I/1r I1s խ1` /P1, ݏHPH.1ݏHPݏHPHw.1ݏlHPݏ*UH~POH8.yݏ7.HWPݏAH@PH-;ݏKGPݏTGP G-15ݏ^GPG-1ݏgGPGn-sݏldGP^GG-Lݏw=GfP7G -%ݏG?PG,1qݏFP F1ݏFPF,sݏFPF,LݏFPyFb,%ݏXFPRF;,1ݏ0FYP*Fݏݏ·1CPHjBj~\4j~ݏַݏȷljjAEjBE1ݏ׷EcPE+cݏٷuEvcPoEX+<ݏ۷NEOcPݏݷ7E8cP1E+ݏ߷E;P E*1ݏDPD*1ݏDPD*1ݏDPD~*sݏtDPnDW*Lݏ MDvPGD0*%ݏ&DOP D *1ݏC'P Cݏ'CPC1@ݏ2CP CLݏ5CPC)%ݏ:vCPpCY)1ݏBNCwP HCݏJ.CWP(C1ݏV C6P C1/ݏ^BP B1ݏgBPݏnBPB(1ݏyBP\ݏvBPEݏ_BP.ݏHBqPݏ1BZP+B(LݏӸ B3PB'%ݏظA PA'1>ݏAPݏAP AcݏAPݏmAPgAP'%ݏFAoP@A)'1ݏ AGP ALݏ@'P@&%ݏ@P@&12ݏ)@P@&1ݏ4@P@j&1ݏ9_@PY@B&lݏE8@aP2@&EݏS@:P @%ݏZ?P?M&ݏbX?%*PsU?1%ݭݏݏd 9c?7P1iL?&ݏݏݏcKݏ^ݏȹݏc%83'ﴲ}tcls$>OPb.b> Џ߹~Џ~ݏɹEW&u> Џ~Џ~ݏWC> ;>P.>,> $>P>> >P>= PPP#P^ݏ)ݏ \bj$PL^Џ*aѬ aԬЬqaЬa$$ ﳹ###ݏXU#P1###*-#+$#,##. #0PPP"}# t#"c#P@ 8``ݏ]U~"P1`ݏaݏeMPR<ݭݏĺU5"P1.<ݏݏۺݏǺ`<hݏ MP;7ݭݏܺT!; ;N;P1PݏݏݏߺC`ݏLP;RݭݏQTr!p; h;N[;Y; Q;MD;P1ݏݏ ݏ_ݏݏX]P1ޭέݏX`YP ݏXݏ ݭQXݏ!ݭ?X߭O : :QM:: :6M|:z: r:Me:P1戴+P1 ݏݏXpP1ޭέݏXsXP ݏXݏ:ݭdWݏQݭRW߭N9 9dL99 9IL99 9.Lx9P1ｋﱋ>P1ݏlݏXDWP}ݏvQݏXݏQ  9 9K88 8K88 8~K8P1M P \PР8PP\ P \PРpPP\s\PРtx\m\<\Z\\P\\F\A\B\ Џ,}5\-m\\\\\ Џ,}\[ \/\IVPխFP\P`; [,[$[ݏ7U7[ݏѬ"= 0PPP[1q[UP~[2[P o[r[=[PР"[![ZP;[ZZ֭ [[[լ"ZZ6ZZO(Zլ Џ~Џ~ݏڻOլ12լ ) ﬈PݏXݏNK}PݏXݏN6)ݏ*N ݏ8N P YPРlPP2խ-ڇ#ЇݏLCNݭݏ3Nլ Џ~Џ~ݏӼNYyYݏM ݏMݏM S~ݏXݏ@Y-YݏVݏGnYݏE[QPXݏoݏNݏhEݏ-X$Q~ uPP^ݏ*PP ^JXݏWXP1r.XP1PxXԭ3P `֭ѭ3Pݏnݏ[YX13XPխЏXP1ݭݏ{ݏoX1' ~bԭO3PQA3Qa`֭ѭ*3P~3ݏ|WP12PP1qW2P 2P =W{n,2PP]2PP]FW}2P o2P ЏVP0[  41Lݏ2~PP V(ݏ1~OP ЏVV1ݏ1~OPݏ1~OP111~ݏV1ݏb1~^OPݏE1~AOP*1$1!1~ݏU2U*P 1P 1PT1xPt1RU1GUݏ½ݏSUP^ݏ߽ݏý,UݏݏUP^ݬݏݏTTЬTЬT70Bݏ0AP!0ЏP1ݏݏݏT/ݏ1ݏrTݏ|ݏPyݏ0yݬݏ\(ݏUݏ29T TP^ԭԭo/ݏgݏVST/=P~ݏoݏhS~ 1ԭ ޭPP`֭ѭԭ6P~ݏ{ݏpsS~ݏgP aݏ$GpPA^ԭ1 Pݭݏ8ݏ)<խ  ݏ901Oj!| ݏL}0P1海Pխ K ݏmL08խ/ ݏz00O ݏf, ݏ/ЭP^ԭԭ;jP1)P1P@@խP1. &PЭPРP>`9QQ9Qa`_c?':9P+9P` #>P>9Q 9Qa`9.P(8P8P`~P8-888.PPPPe6խ*=ʕPP!ѭЏ061vP^6P^Џ,ݭ-PPPݭݏ*+5ݏݏ1ޭPP`7Э7ޭ77ݏ ݏlݏ̘<ݏ8>ݏM 5ݏGݏ,2^ݏ,,Pݭݏ,ݏHݏZݏ,,PSvBPA2 ݏ^,`!N`ݏd%P`1Lݏjݏ,+P.ݏpݏ,+Pݏsݏ,+P@1 ݏv9`ݏ~P`1խzЏ,~AP֭ݭݏ,1g_ݏ,ݭ _!G_ݏ,P_J3@ AP|_&_ @PPT_P^Џ:P^:Pݏ4ݏDݏ̘ݏ8խ J:Pݏ,J^Ьo2ݏ:^P^.^ݏݏXnP+ݏXݏݏ,(ݏ, P1^i PPP//G> ڢPoP` W/ ﻢPoP` t/y/9]ݏXݏ#\/V1~SPݏ,t(֭ݏ,ݏY\\҂Pݏ9#P1y&Pf1000P]0F0P0`-1P1x0Pq0`-1V`0R0J0PC0`P]/0)0!0P] 0 %PH/1ݭ%- ݏ"ݏ'ݏP<ݭ%- ݏ(!ݏLݏ>P^[ Y-1͎P1ѭЏUP-6P6`Q[#ѭ 6P6`ЭP׭Pשּ^ЏP^ЏP^ЏP^ЏP^ЏP^ЏP^ЏP^ЏP^ԭݬ:#P ЏЭP ^ԭԭݬPݬ #Pݬ"PЏݭխ ݭ#ЭP ^ԭԭݬsPݬ S#Pݬm"PЏݭ1խ ݭ#ЭP!^Ь[ZYkPP P P+P-Y[[ ZPQQP0PZk0k9YZPZP^Ь[ZYkPP P P+P-Y[[ ZPQQP0PZk0k9YZPZPPWP PPPЬ[k[^Ь[0 ݬ P^߭$2P 6P1'%PZ1,ZPZm,P[D^Z߭P0߭!ZZjj j߭[] P[?P~GPY ѩ1,ݭfPYPiM1QP^$%P[kݬ(P$[P ^Ь[l$%PZѪ[$ZPQPT^ޭ +^*? f*<P*1*1*Pͬg#ͬ1ͮ:1*ݬ6ЬP1 GWWUUX+ PxrUUUYЭUdUYխNXpЭUU|ЭU`ЭUˏUTpD xUWˏWU1ʏWfR֭ˏWU ֭dH/xWWXWfحDέ=ЭUˏUTdD9 xUWˏWU ֭dH xWWXWխ-q #խխZЭ׭d ֭nTdTa Tխ1ԭԭb qrTqTmխwЭUgEp ? TcTXpTjTЭSnSPcPT0Sqc) TqTwXUUXUpTdTdTЭUdE XpTjTЭSnSPcPT0SXI YѭYVPWYԇYY[XЫUES UXUʏZ.Z VԭxZhUɭUЈUV PVPUXЭg֭ ЈXЭU[zЭP ^ЬUХЬUХRRЭPQBUQU[UZ[UU[ZTTZedkj ЏSSSP[QP ^Ь[ЬZZ[rPխ!~|PЭUЭUԥЭPխ[Z[ЭZԭݫAPЭUЭ Ы[ЭUEUUЪZЭUEUUXYЭUЭTˏeSˏdRRSYSWxWYUTeUUUdTTTTUYUVxVYVWhXѭ5ЭUˏeTYTWxWYUeUUUYUVxVYVWhXѭ׭XUUXeЭUЭЭP ^pЭUUTxUUUTYЭUUUxTTUP[[ˏYʏY YȏЭP߭PZZ UxUUUЭUZ PZPUЭЭUЭXXXX߭4PZЭ ZÏU7UZU Z8[P( 4 ZZ   # * ZZZZZ@#@# &Y~   ##~0  3 4 5 7 A D M P :Z ] ]a d ]k n s v :}            \  /  >  /  /  \  /  \  \isabsoluteisabsolute returnsmain executing init filemain exits init fileInterrupt during initialization or command-line processing.C-Kermit quitting...cl_commandsmain cfilefckcmai got interruptmain cmdfilInterrupt during initialization or command-line processing.C-Kermit quitting...Can't initialize!rx %srx %ssx %ssx -a %srx %srx %srbrbsb %ssb -a %srbrbrbrbsb %ssb -a %srbrbrzrzsz %ssz -a %srzrzkermit -irkermit -rCan't allocate i/o buffers!Can't open device: /dev/ttyCan't allocate packet buffers!main argc after prescan()main 2 cfilefmain argcckcmai setting interrupt trapgetiobs okC-Kermit 6.0.192C-Kermit 6.0.192, 6 Sep 96 For further information, contact the Kermit Project, Columbia University,612 West 115th Street, New York NY 10025-7799, USA; phone +1 (212) 854 3703,fax +1 (212) 663 8202 or +1 (212) 662 6442, email kermit@columbia.edu,Web http://www.columbia.edu/kermit/.C-Kermit Server REMOTE Commands: GET files REMOTE CD [dir] REMOTE HOST command REGET files REMOTE SPACE [dir] REMOTE DIRECTORY [files] RETRIEVE files REMOTE DELETE files REMOTE LOGIN user password SEND files REMOTE PRINT files REMOTE SET parameter value RESEND files REMOTE TYPE files REMOTE QUERY type variable MAIL file user REMOTE WHO [user] REMOTE ASSIGN variable value FINISH, BYE REMOTE HELP Entering server mode. If your local Kermit software is menu driven, use the menus to send commands to the server. Otherwise, enter the escape sequence to return to your local Kermit prompt and issue commands from there. Use SEND and GET for file transfer. Use REMOTE HELP for a list of other available services. Use BYE or FINISH to end server mode. KermitXMODEMYMODEMYMODEM-gZMODEMOtherU10anonymousA1Apple IIA3MacintoshD7VMSDARSTS/EDBRT11F3AOS/VSI1VM/CMSI2MVS/TSOI4MUSICI7CICSI9MVS/ROSCOEK2Atari STL3AmigaMVStratus VOSN3Apollo AegisU1UNIXU8MS-DOSUDOS-9UNWindows-32UOOS/2Tsysinit calling priv_iniFatal: setuid failure. Fatal: setgid failure. Fatal: C-Kermit setuid to root! ttopen telnetfdttopen entry modem ttyfd lclttopen MAXNAMLEN definedttopen BSD4 definedttopen BSD42 *NOT* definedttopen MYREAD definedttopen got open fdttopen fdflagttopen alarmttopenmodem ttyfd alarm returnttopen ttyfdttopen tty access denied/dev/null%s is not a terminal device ttopen not a tty/dev/tty ttname=CTTNAM cname ttyname redirected stdinttopen setting ttyfd = 0ttopen stdio redirectedttopen ttlock failsttopen reading lockfile pidLocked by process %d %s %sttopen BELLV10 ttold.sg_flagsttopen BELLV10 tdold.flagsttopen TIOCGETC failedttopen TIOCGETC okttopen TIOCGLTC not definedttopen ttspeedttopen, ttyfd lcl lock filettclos ttyfdttclos about to call ttunlckWarning, problem releasing lock ttclos alarmttclos calling tthang()ttclos calling ttres()ttclos about to call close?Timed out closing device: %s ttclos timed outttclos donettres TIOCSETC failedttres TIOCSETC okttres tty modes restorettres errnottrpidttrpid integer readttrpid pid/usr/spool/uucpLCK..%s%s/%s%s/LTMP.%05dttlock flfnamttlock tmpnamttlock creat failedUUCP not installed or Kermit misconfigured ttlock pidttlock fpidttlock killttlock kill errnottlock removing stale lockRemoving stale lock %s (pid %d terminated) ttlock unlinkttlock found tty lockedttlock can't get fpidWarning - Can't remove lockfile: %s ttpkt parityttpkt xflowttpkt speedttpkt ttpmskttpkt netconnttpkt carrierttpkt hard flow, TANDEM off, RAW onttpkt no flow, TANDEM off, RAW onttpkt keeping original TANDEMttpkt turning on TANDEMttpkt cooked, cbreak, parityttpkt TIOCSETC failedttpkt TIOCSETC okttpkt setting rawmode, parityttpkt stty okttvt ttyfdttvt tvtflgttvt speedttvt flowttvt modes already set, skipping...ttvt using external fd, skipping...ttvt setting modes...ttvt donettsspd cpsttsspd ttyfdttsspd xlocalttsspd okttsspd sttsspd failsttsspd BELLV10 ioctlttsspd BELLV10 errnocongspdttgspd ttyfdttgspd cfgetospeed 1 catch-allttgspd cfgetospeed 2 BELLV10ttgspd codettgspd speedmyfillbuf readmygetbuf errnoSERIALmyfillbuf FIONREADmyfillbuf FIONREAD availmyfillbuf FIONREAD errnomyfillbuf availmyfillbuf readmyfillbuf read errnottflui ttyfdttflui TIOCFLUSH ANYBSDBSD conbgt process groupnon-POSIX conbgt terminal process groupconbgt process group testNOJCjcconbgt jcconbgt osigintconbgt signal testconbgt isatty testconbgt backgrdconint backgrdconint jcconint background ignoring signals, jcconint foreground catching signals, jcconint SIGSTSTPconnoiin_chk FIONREAD return codein_chk FIONREAD countin_chk my_countttxin nttxin MYREADttxin myread returnsttol nttol sttol tryttol okttol failedttol partialttoc timeoutttoc flowttoc errorttinl maxttinl timottinl alarmttinl timoutttinl startttinl eolttinl myread failure, nttinl myread errnottinl myread ittinl untimed network myread failsttinl lengthttinl length^C... ttinl skippingttinl EOP lengthttinl ittinl got eolttinl senses parityttinl packet beforettinl packet after ttinl gotttsndb ttyfdsndbrk catchallmsleep SELECT 1msleep SELECT 2msleep BELLV10 selectgtimerztime: ZTIMEV7congm getting modes/dev/ttyconcb cgmfconcb backgrdconcb ttyfdconcb ttfdflgconcb isattyconcb suspendconcb returnsconbinconres cgmfconres isatty okconres restoring stty conchk contypconinc(0) errnoconinc HORRIBLE ERRORconinc alarm setconinc(timo) nconinc(timo) errnottscarrcarrctlUNIX Communications support, 6.0.169, 6 Sep 96 Bell Labs Research UNIX V10/dev/ttynone% &=&D&H&L&Q&X&_&d&o&s&;Zx0N{&' zopeni fpzopeni called with ZSYSFN, failing!Terminal input not allowedzopeni: attempts input from unredirected stdinr zopenizopenizopenozopeno fcb dispzopeno fcb typezopeno fcb charzopeno fcb is NULL zopeno fp[]=stdoutwazopeno appendzopeno fopen argzopeno failed errnozopeno okzclose fclose failszclose error flushing last bufferzclose successzsinlZINFILL feofZINFILL freadZINFILL ferrorZINFILL errnoZINFILL count 0 EOF return -1ZINFILL count 0 not EOF return -2 zoutdump charszoutdump write okzoutdump write errorzoutdump write returns/dev/nullzchki stat failszchki skipping:zchki stat ok: access failed: access ok: length/dev/nullMalloc error 46 izchko access failed:zchko access ok:zrtol original nameNONAMEzrtol new namezstrip beforezstrip after tilde-strippingzstrip afterzltor name2zchdirzchdir 2zchdir 3HOME.zgtdir getwd()wzxcmd pipe failure/bin/shzxcmd pid/dev/nullSHELLzxcmd...-czxcmd fork failurezxcmd pidwrzclosf filnumzclosf fp[filnum]zclosf fp[ZSYSFN]zclosf killing pidzxpand entryzxpand after tilde_xzxpand okzxpand fgen1zxpand fgen2 okzxpand 2 not okznextznewn: about to expandznewn matchesznewn number ok.~%d~znewn: too many names.~xxxx~zrename oldzrename new/zrename dirzrename no dirzrename link fails, errnozrename unlink fails, errnozcopy sourcezcopy destination/zcopy dirzcopy no dirU1zdatstr timelocaltime returns nullzdatstr year%04d%02d%02d %02d:%02d:%02dzdatstrzfcdat stat failedzstrdtBad creation date zstime date check 1Bad creation date zstime date check 2Bad creation date zstime date check 3zstime BSD calling ftimezstime BSD back from ftimezstime BSD timezonezstime so far so goodzstime yearzstime fails - yearzstime 4 bad date zstime 6 bad date zstime 9 bad date zstime 12 bad date zstime 15 bad date zstimezstimezstime: zstrdt failszstime: tmzstime: A-pkt date ok zstime: Can't stat file:zstime: sb.st_atimezstime 0: can't set modtime for filezstime 0: modtime set for filezstime 1: comparezstime 1: comparepacketMail -s %c%s%c %s < %szprint filezprint flagszprint printfilezprint printpipecat %s | %scat %s >> %s%s %s < %slprzprint command%s %ssplitpathsplitpath mallocsplitpath malloc failurefgen patfgen string spacefgen can't malloc string space addresultmatch strmatch skipUSERtilde_expand?Privilege cancellation failure /bin/shsh-c/bin/sh/bin/shSHELL-i-cisdir statisdir errnoisdir statbuf.st_modezmkdirzmkdir tilde_expandzmkdir tp after tilde_expansionzmkdir makingzmkdir failed, errnozfseekUNIX File support, 6.0.115 6 Sep 96 Bell Labs Research UNIX V10rm -f cp mv pwd ls -l ls -l cat pwd ; df .df finger echo6667777$7(7/7encstr string too bigencstr fits OK, sizeputfil zchout write error, setting czseendecode _write error - errnogetpkt: empty stringgetpkt: empty input functiongetpkt funcstrgetpkt: input errorgetpkt empty filegetpkt 1st chargetpkt fmaskgetpkt new rtgetpkt eof crc16getpkt eof ffcgetpkt leftovergetpkt osizegetpkt eof/eottinit bestlentinit setting justone=0tinit getsbufTransaction beginsGlobal file mode:binarytextCollision action:resetc fsizefnlist: no memory for cmargbufsinit nfilssinit cmargsinit cmarg2stdinsinit gnfilToo many files match wildcardCancelledRead access deniedFile is not readableNo files matchFile not foundNo filespec given!sinit nfilssinit filnamTransaction beginsGlobal file mode:binarytextsinit oksipkt pktnumsipkt ksipkt getsbufxsinit kNONAMErcvfilrcvfil cmarg2Receivingrcvfil substituting cmarg2rcvfil zstripUNKNOWNUNKNOWNrcvfil asrcvfil dirflgrcvfil ofn1x/dev/nullrcvfil existsrcvfil appendCan't append to a directory error - can't append to directory appending toCan't rename existing directory error - can't rename directory backup:rcvfil backup ofn1rcvfil backup ofn2rcvfil discard refused: namercvfil overwriteCan't overwrite existing directory error - can't overwrite directoryoverwritingrcvfil updateFile has same name as existing directory error - directory exists:rcvfil bad collision actionrcvfil ofn1rcvfil ofn2rcvfil calling zmkdirzmkdir fails error - directory creation failure:Directory creation failure.rcvfil: nreof fncactreof discardreof discardingreof successreof cxseenreof czseenreof rdatapreof successmailed toprinted with optionsreof returnssfile cmarg2sfile fnspathsfile zstripUNKNOWNUNKNOWNSATURDAY fncnvsfile pktnamsxpackSending as mode: binary mode: textSending from:SFILE fsecssdata entry, first drainsdata draining, winlosdata sbufnumsdata countdownsdata packetsdata cx/zseen, drainsdata spsizsdata eof, drainsdata ttchk *** interrupted, sending discard requestseof can't get s-buffersxeof nxtpkt failssxeof packetrpar 8bq sqrpar 8bq ebqrparentering sparspar 8bq rqspar 8bq sqspar 8bq ebqspar 8bq rqfspar capasspar lscapuspar lscaprspar ebqflgspar swcaprspar swcapuspar lscapuspar yspar lpcapuspar lp lenspar slow-start spsizspar lp spmaxspar windowspar window after adjustmentspar windowspar no windowsspar sending, redefine spmaxRemote system type: gnfile sndsrcTransaction cancelledgnfile czseengnfile nfils?Internal error expanding ADD list gnfile addlist filnamgnfile cmlist filnamgnfile ngetpathgnfile getpathgnfile absolutegnfile wildgnfile zxpandgnfile znextgnfile donegnfile znextgnfile skipping:not sent, reasonRead access deniedtypenxtdirfuncnxtnxtdir funcbuf %04d-%02d-%02d %02d:%02d %11ld %s %04d-%02d-%02d %02d:%02d %11s %s (directory) %sSummary: %ld director%s, %ld file%s, %ld byte%s%syiessssnddir./*Listing files: "%s" snddir zxpandnxpndREMOTE DIRECTORYsnddirsinit() %10s: %s skippingdeleted directory: %s %ld file%s deleted, %ld byte%s freed ssDeleting "%s" REMOTE DELETEDirectory requested: cwdChanged directory tocwd failedFailed to change directory tosyscmdsyscmd zxcmd oksyscmd zxcmd failedremsetremsetadjpkl lenadjpkl slotsadjpkl bufsizadjpkl new lenwhoarewe xfermodewhoarewe remote sysidL3N3whoarewe flagC-Kermit functions, 6.0.133, 6 Sep 96Error receiving filerenamereplacebackupappenddiscardaskupdate !"$'(+-.03569:RetransmissionRESEND PKT NOT IN WINDOWRESEND kresend pktinfo indexToo many retries. retry(resend)resend ttol returns(resend)kstart SOPkstart EOPB00zstart Zmodem SOPentering rpack, pktnumrpack getrbufrpack: ttinl failsrpack ^C serverrpack ^C en_finBad packet headerrpack packet length less than 3Bad packet lengthrpack bad sequence numberBad sequence numberrpack echorpack bctlrpack chklenpacket sticks out too farrpack block check Bchecked charsblock checkshould beChecksum errorchecked charsblock checkshould beChecksum errorchecked charsblock checkshould beCRC errorbad type B block checkChecksum error(crunched)rpack block check OKrpack got dup%c-xx-%02d-%c-%02d-%02d-Transaction complete files transferred total file characters communication line in communication line out elapsed time (seconds) effective data rate complete, sizeWZ#Z#PPPPPPPPQ QQQ(Q3Q>QEQLQZQ_QaQcQeQgQiQkQmQoQqQsQuQwQyQ~Q inibufs sinibufs rini_pkts: no memory for s_pktini_pkts: no memory for s_pktinibufs size 1inibufs size zinibufs overflowinibufs bigbuf malloc failedinibufs size 2inibufs bigsbsizinibufs bigrbsizmakebufmakebuf bufsizmakebuf MAXWSmksbuf makebuf returnmksbuf makebuf returnmkrbuf makebuf returnmkrbuf makebuf returnwindowgetsbuf bad arggetsbuf, packetgetsbuf, sbufnumgetrbuf rbufnumgetrbuf wslotsgetrbuf dum002getrbuf dum003getrbuf new rbufnumgetrbuf foulupfreesbuf sseqtbl[n]freerbuf, slotfreerbuf no such slotfreerbuf, packetfreerbuf, new rbufnumfreerpkt seqfreerpkt kfreerpkt freerbufchkwin packetchkwin winlochkwin slotsSEND BUFFERS:buffer inuse address length data type seq flag retries%4d%6d%10d%5d%6d%4c%5d%6d [%.72s%s] ...[(empty string)] [(null pointer)] free: %d, winlo: %d RECEIVE BUFFERS:buffer inuse address length data type seq flag retries%4d%6d%10d%5d%6d%4c%5d%6d [%.72s%s] ...free: %d, winlo: %d %ld%ld%dsattr pkt too longsattr spsizsattrnameunknownrsattr: refused refused:rsattr RESEND nrsattr RESEND zrsattr RESEND sendstartgtattr: no memory for dsbufgattr file typegattr binary refused: typegattr attribute A = textgattr attribute B = binary refused: dategattr encodinggattr unk encoding attribute refused: encodinggtattr: no memory for dsbuf refused: bad disposition refused: mail disabled refused: print disabledgattr RESENDgattr: no memory for spbufgattr length refused: length bytes refused: length K%ldgattr fsizegattr RESENDN+gattr RESEND not binary%ldgattr RESEND OKN?gattr returnAttributes for incoming file length in K file type creation date creator account area password blksize access encoding disposition lprotection gprotection systemid recfm sysparam length replyopena fopena discardopena xflgopena remfileopena remappdopena dispopen dispositionopena disposopena rename failsCan't create backup fileopena rename okopena [file]=mode: local name: mode: binary mode: text opena charsetCan't open output fileFailure to openError:opena errorcanned: cxseen czseenopeni sndsrc file numberauthorization failure openi authorization failure ok zopeni okcould not be opened openi failedopeno: name open cancelledauthorization failure openo authorization failureopeno failedFailure to openopeno ok, nameclsof dispFailure to closeIncomplete: discarded incomplete: discardedIncomplete: Kept incomplete: keptClosedsizetypedatecreatoraccountareapasswordblocksizeaccessencodingdispositionprotectionprotectionoriginformatsys-dependentsize23456789:;<=>name@TfrfQ====================================;=========================== ==========<=== =========================================== =================== ======= ==========<=== ========================================.==;*=================+======== ==========<=== =======================================,==-;====================0====== ==========<=== ==========================================/;====================1====== ==========<=== =========================================5=;=4==========3======2======= ==========<=== ===========================================;===================6======= ==========<=== ===========================================;===================7======= ==========<=== ===========================================;===================8======= ==========<=== ===========================================;===================9======= ==========<=== ===========================================;===================:======= ==========<=== =======   (((((((((((((((((((((((((((((((((((!((((( "#$&%((((((((( (((((((((('((( (((((((====================================;============ ============ ==========<=== ===========================================;*============ ====+)======= ==========<=== =======x justone 1x justone 2User cancelledUser cancelledLogin requiredSEND disabledreceive download dirreceive current dirreceive zchdir okreceive zchdir failedREGET sstateCommand too long for serverCommand too long for serverCommand too long for serverCommand too long for serverLogin requiredLogin requiredRETRIEVE disabled - use GETDeleting files disabled - use GETLogin requiredLogin requiredBadly formed server commandLogin requiredREMOTE HOST disabledCan't do system commandQUIT disabledDid you say RECEIVE instead of GET?Unimplemented server functionXXX userXXX passXXX acctLogged outLogged outYou were not logged inLogged inLogged inLogin failedLogin failedNo login requiredREMOTE CD disabledCan't change directoryREMOTE CD disabledREMOTE DIRECTORY disabledAccess deniedCan't list directoryREMOTE DELETE disabledAccess deniedCan't remove fileFINISH disabledBYE disabledC-Kermit BYECan't send helpREMOTE RENAME disabledAccess deniedCan't rename fileREMOTE COPY not availableREMOTE SET disabledUnknown REMOTE SET parameterREMOTE TYPE disabledAccess deniedCan't type fileREMOTE SPACE disabledAccess deniedCan't check spaceREMOTE WHO disabledCan't do who commandREMOTE QUERY disabledCan't get valueValue too longCan't send valueREMOTE ASSIGN disabledREMOTE ASSIGN failedBadly formed server commandQUIT disabledUnimplemented REMOTE commandCan't open windowCan't open windowXCan't open fileError writing datackcpro.w B tmpdir restoringXZError writing dataCan't create fileCan't print fileCan't mail fileCan't delete temp fileCan't close fileRESEND capabilities not negotiatedRESEND capabilities not negotiatedCan't execute commandCan't open file remote name:Can't send attributesCan't open windowDCan't open windowD deletingCan't open filesseot justoneUnknown errorckcpro.w justone at E pktProtocol errorckcpro.w E tmpdir restoringUnexpected packet typexxproto entry justoneSorry, you must 'set speed' firstfailed: proto ttopen localCan't open lineproto ttopen localCan't condition line Sorry, only Kermit protocol is supported in this version of Kermit server backgrdserver quietSHOULD NOT SEE THIS IF IN BACKGROUND!KERMIT READY TO SERVE...Entering server mode on Type Ctrl-C to quit.Return to your local Kermit and give a SEND command.KERMIT READY TO RECEIVE...Return to your local Kermit and give a RECEIVE command.KERMIT READY TO SEND...Return to your local Kermit and give a SERVER command.KERMIT READY TO GET...KERMIT READY TO SEND SERVER COMMAND...proto calling wart, justoneC-Kermit server doneGET disabledsgetinit whatrusgetinit binary (1)sgetinit binary (2)Wart Version 2A(010) 4 Apr 95C-Kermit Protocol Module 6.0.095, 6 Sep 96hrNr %s %s%s%s ?Memory allocation failure ?Name too long - %s %s %s%s%s PROMPT sxPROMPT sy %spushcmd: savbuf:&cmpushcmpush: no memory for cmp&cmpop&cmpopcmnum: illegal radix - %d cmnum: cmfldcmnum 1st chknum okcmnum xxesc okcmnum zpcmnum 2nd chknum okcmnum xxesc 2 okcmnum exp eval okOutput filecmofi 1cmofi 1.5cmofi 2?Name too long cmofi 3?Wildcards not allowed - %s cmofi 4cmofi 5: is directory/dev/ttycmofi 6: failure?Write permission denied - %s cmofi 7: ok?Default input filename too long cmifi gtwordcmifi switch xCommand or field too long cmifi atxbuf?malloc error 73, cmifi cmifi svcmifi sv wildcmifip add path?No files match - %s ?Too many files match - %s cmifi sv not wild?Read permission denied - %s ?File not readable - %s ?File not found - %s cmifi esc, xc%s Default input filename too long Expanded input filename too long ?No files match - %s ?Too many files match - %s cmifi partialcmifi partial k%scmifi partial cmdbuf?Partial filename too long cmifi partial atmbuf/%s?Directory name too long cmifi directory atmbuf%s ?Completed filename too long Input file specification %s?Expanded filename too long cmifi ? *xp, cccmifi ? wild?No files match - %s ?Too many files match - %s , one of the following: %s%s?Default directory name too long cmdir gtwordCommand or field too long Directory name %s %s%s?Default too long cmfld: gtwordcmfld xCommand or field too long ?Default too long Value too long ?Default too long cmfld returns%s ?Default too long Please complete this field %s %s%scmtxt, cmflgscmtxt: fresh startcmtxt:cmtxt (*f)cmtxt: gtword xCommand or field too long cmtxt calling (*f)cmtxt (*f) returns%s %s cmtxt: addbuf Text string %s %s%s?Unexpected return code from gtword() - %d cmkey: cmflgscmkey: cmdbuf?Default too long cmkey: table length cmflgs zzcmkey: gtwordCommand or field too long ?Default too long cmkey atxbuf after *fEvaluated keyword too long ?Ambiguous - %s ?No keywords match - %s %s ?Default too long cmkey: defaultEvaluated keyword too long cmkey: esc?No keywords match - %s %s cmkey: addbuf?Evaluated keyword too long No keywords match One of the following: %s, one of the following: or the token %c or one of the tokens: %s %s%s %d - Unexpected return code from gtword cmcfm: cmflgscmcfm: atmbufCommand or field too long ?Not confirmed - %s ?Not confirmed - %s Type a carriage return to confirm the command %s%sungword cmflgsgtword ungetting from pp?Saved word too long gtword returning atmbufgtword: cmdbuf bp ppgtword EOF?Field too long error 1 gtword too long #1gtword too long #2?Field too long error 2 Oops, command recall error gtword too long #3?Too long #3 gtword too long #4?Too long #4 %s %s%s %s%sgtword quote?Command too long, maximum length: %d.  chknumCommand package 6.0.088, 6 Sep 96Command? d(m"c`!_3z{ mϷ_E۹(*+lAۻNxϼܼ f-q*f4Nq0N}@~EoC8bMp~.ab(_  S4HI+rO)*cw"#U&rN=+sLx jGB KnL h:Y|-t89c>Ka@!34R(qyz\9 )*U0}Z81| (D]x*L9Y(n dR1Tc2c8Z D-jE$lJX?_>bd5dc?{T-w Qk.F 8 x   R l   ; V    * s    J     D}1u]y0y@]>SwEF^2wbO/yc!Lt,DEOH+_`|1 }  !2!i!!!-"v""""7#E#F###$a$$$$ %U%%%%&b&&&H'''(H((( )W)))*!*<*J*K*h***:+;+{++,\,,,,)-q----.U...../(/k/////0^0000 1 131S1112P2Q2v222,3e3f333 4R4S4w445O555636A6667X777778$8%8J8o888A9999999::/:z:::: ;g;;;;<G<<<<4=e===)>o>>>>>$?n??@A@Q@R@m@@@@@AbAAAB'B(B?BBBCeCCCDDTDmDDDEkEEEE FVFFFF GSG`G}GGGGGGDHHHHHILIII0J{JJJJJKOKeKuKKKELLLLHMMMMN&NYNNNOXOOO/PxPP Q;QQQQQ6RxRRR>SjSSS(TgTTTTTUdUUUU VUVVVVV$WpWWWWX9XXXXY^YYYY3Z~ZZ[([s[[[\P\}\~\\\0]x]]]]^`^^^_'_\___` `,`o```aOaaaa)bDbbbb,cxccccd2dyddd-eseteeee>fff!g:gbgggBhhhhibiziijEjjjk1k~kk l>llll0m]mmmn0nenfnnnn"oloooooHppp%q&qFqqq!rhrrrrsesysssst9tOttt u5uyuuuuu3vHvvvv6wwww x$xbxqxxxxxEyyyy z5zxzzzz{8{M{{{{,|^|k||||}B}}}~^~~~~~CD݀)Jˁ]3ƒI%KUsage: DOHELP xxSyntax: APC text Echoes the text in the form of a VT220/320/420 Application Program Command. Use the APC command to send commands to MS-DOS Kermit 3.13 or later.Describes how to get technical support.Syntax: BEEP Sends a BEL character to your terminal.Syntax: CHECK name Checks to see if the named feature is included in this version of C-Kermit. To list the features you can check, type "check ?".Syntax: CLEAR [ { DEVICE, INPUT, DEVICE-AND-INPUT, DIAL-STATUS, SEND-LIST } ] Clears the communications device input buffer, the INPUT command buffer, or both. CLEAR SEND-LIST clears the SEND list (see ADD). CLEAR DIAL-STATUS clears the \v(dialstatus) variable. The default is DEVICE-AND-INPUT.Syntax: COMMENT text Example: COMMENT - this is a comment. Introduces a comment. Beginning of command line only. Commands may also have trailing comments, introduced by ; or #.Your escape character is Ctrl-%c (ASCII %d, %s) DELSyntax: COPY source destination Copy the file 'source' to 'destination'.Syntax: CD [ directoryname ] Change Directory. If directory name omitted, changes to your home directory.Syntax: DECLARE arrayname[size] Example: DECLARE \&a[20] Declares an array of the given size. Array elements can be used just like any other variables.Syntax: UNDEFINE variable-name Undefines a macro or variable.Syntax: DELETE filespec Delete a local file or files. RM is a synonym for DELETE.Syntax: PDIAL phonenumber Partially dial a phone number. Like DIAL but does not wait for carrier or CONNECT message.Redial the number given in the most recent DIAL commnd.Syntax: DIRECTORY [ filespec ] Display a directory listing of local files.Syntax: DISABLE command Security for the C-Kermit server. Prevent the client Kermit program from executing the named REMOTE command, such as CD, DELETE, RECEIVE, etc.Syntax: [ DO ] macroname [ arguments ] Execute a macro that was defined by the DEFINE command. The word DO can be omitted. Trailing argument words, if any, are automatically assigned to the macro argument variables \%1, \%2, etc.Syntax: ECHO text Display the text on the screen, followed by a line terminator. The ECHO text may contain backslash codes. Example: ECHO \7Wake up!\7Syntax: XECHO text Just like ECHO but does not add a line terminator to the text. See ECHO.Syntax: ENABLE capability For use with server mode. Allow the client Kermit program access to the named capability, such as CD, DELETE, RECEIVE, etc. Opposite of DISABLE.Syntax: END [ number [ message ] ] Exit from the current macro or TAKE file, back to wherever invoked from. Number is return code. Message, if given, is printed.Syntax: E-PACKET Send an Error packet to the other Kermit.Syntax: QUIT (or EXIT) [ number ] Exit from the Kermit program, closing all open files and devices, optionally setting the program's return code to the given number.Syntax: FINISH Tell the remote Kermit server to shut down without logging out.Syntax: GETOK prompt Print the prompt, make user type 'yes', 'no', or 'ok', and set SUCCESS or FAILURE accordingly.Syntax: GOTO label In a TAKE file or macro, go to the given label. A label is a word on the left margin that starts with a colon (:). Example: :oofa echo Hello! goto oofaSyntax: HANGUP Hang up the phone or network connection. %s, Copyright (C) 1985, 1996,Give a brief introduction to C-Kermit.Syntax: REINPUT n string Look for the string in the text that has recently been INPUT, set SUCCESS or FAILURE accordingly. Timeout, n, must be specified but is ignored.Syntax: RENAME oldname newname Change the name of file 'oldname' to 'newname'.Introduce a label, like :loop, for use with GOTO in TAKE files or macros. See GOTO.Syntax: MAIL filename address Send the file to the remote Kermit, which must be in RECEIVE or SERVER mode, and request that the remote host deliver the file as electronic mail to the given address. Example: MAIL BUG.TXT KERMIT@CUVMAMMOVE is exactly like MSEND, except each file that is sent successfully is deleted after it is sent. Print news of new features since publication of "Using C-Kermit".Syntax: OUTPUT text Send the text out the currently selected line, as if you had typed it during CONNECT mode. The text may contain backslash codes. Example: OUTPUT help\13Syntax: PRINT file [ options ] Print the local file on a local printer with the given options.Syntax: PWD Print the name of the current working directory.Syntax: READ variablename Read a line from the currently open READ or !READ file into the variable (see OPEN).Remote commandSyntax: RETURN [ value ] Return from a macro. An optional return value can be given for use with with \fexecute(macro), which allows macros to be used like functions.MOVE is exactly like SEND, except each file that is sent successfully is deleted after it is sent.ParameterHELP SET ySorry, help not available for "%s" Display current values of various items (SET parameters, variables, etc). Type SHOW ? for a list of categories.Syntax: SPACE Display disk usage in current device and/or directorySyntax: STATISTICS Display statistics about most recent file transferSyntax: STOP [ number [ message ] ] Stop executing the current macro or TAKE file and return immediately to the C-Kermit prompt. Number is a return code. Message printed if given.Syntax: TAKE filename Take Kermit commands from the named file. Kermit command files may themselves contain TAKE commands, up to a reasonable depth of nesting.Syntax: TYPE file Display a file on the screen. Pauses if you type Ctrl-S, resumes if you type Ctrl-Q, returns immediately to C-Kermit prompt if you type Ctrl-C.Syntax: VERSION Displays the program version number.Syntax: WHO [ user ] Displays info about the user.WRITE-LINE (WRITELN) is just like WRITE, but includes a line terminator at the end of text. See WRITE.Like GOTO, but searches only forward for the label. See GOTO.Declares a variable to be local to the current macro or command file.View the terminal emulation screen even when there is no connection. Synonym for SET FILE TYPE TEXT. Synonym for SET FILE TYPE BINARY. Prints the current date and time. Just like GET but asks the server to delete each file that has been sent successfully. Equivalent to SET PARITY NONE, SET COMMAND BYTE 8, SET TERMINAL BYTE 8. Syntax: SAVE KEYMAP Saves current keymap definitions to file, "keymap.ini" by default.Sorry, help not available for "%s" %s %s Syntax: SET CASE { ON, OFF } Tells whether alphabetic case is significant in string comparisons done by INPUT, IF, and other commands. This setting is local to the current macro or command file, and inherited by subordinates.Syntax: SET INCOMPLETE { DISCARD, KEEP } Discard or Keep incompletely received files, default is KEEP.Syntax: SET COUNT number Example: SET COUNT 5 Set up a loop counter, for use with IF COUNT. Local to current macro or command file, inherited by subordinate macros and command files.Syntax: SET DEBUG { SESSION, ON, OFF } SESSION means display control and 8-bit characters symbolically during CONNECT mode. ON means log debugging information to file debug.log.Syntax: SET DEFAULT directory Change directory. Equivalent to CD command.Syntax: SET DELAY number Number of seconds to wait before sending first packet after SEND command.Syntax: SET SUSPEND { OFF, ON } Disables SUSPEND command, suspend signals, and Z during CONNECT.Syntax: SET SCRIPT ECHO { OFF, ON } Disables/Enables echoing of SCRIPT command operation.Syntax: SET DUPLEX { FULL, HALF } During CONNECT: FULL means remote host echoes, HALF means C-Kermit does its own echoing.Syntax: SET LOCAL-ECHO { OFF, ON } During CONNECT: OFF means remote host echoes, ON means C-Kermit does its own echoing. Synonym for SET DUPLEX { FULL, HALF }.Syntax: SET ESCAPE number Decimal ASCII value for escape character during CONNECT, normally 28 (Control-\). Type the escape character followed by C to get back to the C-Kermit prompt or followed by ? to see other options.Syntax: SET OUTPUT PACING How many milliseconds to pause after sending each OUTPUT character. Syntax: SET LINE devicename or: SET PORT devicename Select communication device to use. Normally %s. If you SET LINE to other than %s, then Kermit will be in 'local' mode; SET LINE alone will reset Kermit to remote mode. To use the modem to dial out, first SET MODEM TYPE (e.g., to HAYES), then SET LINE xxx, next issue the DIAL command, and finally CONNECT. Syntax: SET PARITY name Parity to use during terminal connection and file transfer: EVEN, ODD, MARK, SPACE, or NONE. Normally NONE.Syntax: SET QUIET {ON, OFF} Normally OFF. ON disables most information messages during interactive operation.Syntax: SET RETRY number How many times to retransmit a particular packet before giving up.Syntax: SET SESSION-LOG { BINARY, TEXT } If BINARY, record all CONNECT characters in session log. If TEXT, strip out carriage returns.Syntax: SET SPEED number Communication line speed for external tty line specified in most recent SET LINE command, in bits per second. Type SET SPEED ? for a list of possible speeds.Syntax: SET WILDCARD-EXPANSION { KERMIT, SHELL } KERMIT (the default) means C-Kermit expands filename wildcards in SEND and MSEND commands and incoming GET commands. SHELL means your shell does it.Syntax: SET ALARM [ ] Number of seconds from now after which IF ALARM will succeed. 0 means no alarm.Syntax: SET PREFIXING { ALL, CAUTIOUS, MINIMAL, NONE } Selects the degree of control-character prefixing. Also see HELP SET CONTROL.Syntax: SET TEMP-DIRECTORY [ ] Overrides automatic assignment of \v(tmpdir) variable.Syntax: SET TITLE Sets window title to text instead of using current host/port name.Not available - "%s" Syntax: REMOTE COPY source destination Ask the remote Kermit server to copy the source file to destination.Syntax: REMOTE CD [ name ] Ask remote Kermit server to change its working directory or device. If the device or directory name is omitted, restore the default.Syntax: REMOTE DELETE filespec Ask the remote Kermit server to delete the named file(s).Syntax: REMOTE DIRECTORY [ filespec ] Ask the remote Kermit server to provide a directory listing of the named file(s) or if no file specification is given, of all files in the current directory.Syntax: REMOTE HELP Ask the remote Kermit server to list the services it provides.Syntax: REMOTE HOST command Send a command to the remote host computer in its own command language through the remote Kermit server.Syntax: REMOTE KERMIT command Send a command to the remote Kermit server in its own command language.Syntax: REMOTE LOGIN user password [ account ] Log in to a remote Kermit server that requires you login.Syntax: REMOTE LOGOUT Log out from a remote Kermit server to which you have previously logged in.Syntax: REMOTE PRINT filespec [ options ] Send the specified file(s) to the remote Kermit and ask it to have the file printed on the remote system's printer, using any specified options.Syntax: REMOTE RENAME filespec newname Ask the remote Kermit server to rename the file.Syntax: REMOTE SPACE [ name ] Ask the remote Kermit server to tell you about its disk space on the current disk or directory, or in the one that you name.Syntax: REMOTE TYPE file Ask the remote Kermit server to type the named file(s) on your screen.Syntax: REMOTE WHO [ name ] Ask the remote Kermit server to list who's logged in, or to give information about the named user.Syntax: REMOTE QUERY { KERMIT, SYSTEM, USER } variable-name Ask the remote Kermit server to send the value of the named variable of the given type, and make it available in the \v(query) variable.Syntax: REMOTE ASSIGN variable-name [ value ] Assign the given value to the named global variable on the server.not working yet - %s [cmdfile] [-x arg [-x arg]...[-yyy]..] [ = text ] ] -x is an option requiring an argument, -y an option with no argument. actions: -s files send files -r receive files -s - send from stdin -k receive files to stdout -x enter server mode -f finish remote server -g files get remote files from server (quote wildcards) -a name alternate file name, used with -s, -r, -g -c connect (before file transfer), used with -l and -b -n connect (after file transfer), used with -l and -b settings: -l dev communication line device -q quiet during file transfer -i binary file transfer -b bps line speed, e.g. 19200 -t half duplex, xon handshake -p x parity, x = e,o,m,s, or n -d log debug info to debug.log -y name alternate init file name -Y no init file -e n receive packet length -w write over files -v n sliding window slots -z force foreground -m name modem type -R remote-only advisory other: -C "command, command, ..." (interactive-mode commands to execute) = means ignore following words, but place them in array \&@[]. If no action command is included, or -S is, enter interactive dialog. Trustees of Columbia University in the City of New York. Type INTRO for a brief introduction to C-Kermit. Type VERSION for version and copyright information. Type HELP followed by a command name for help about a specific command. Type NEWS for news about new features. Type BUG to learn how to get technical support. Press ? (question mark) at the prompt, or anywhere within a command, for a menu (context-sensitive help, menu on demand). From system level, type "kermit -h" for help about command-line options. DOCUMENTATION: "Using C-Kermit" by Frank da Cruz and Christine M. Gianone,2nd Edition, Digital Press / Butterworth-Heinemann 1997, ISBN 1-55558-164-1.To order: +1 212 854-3703 or +1 800 366-2665. PLEASE PURCHASE THE MANUAL.It shows you how to use C-Kermit and answers your questions; sales of thisbook are the primary source of funding for C-Kermit development and support. Welcome to C-Kermit 6.0. This version of C-Kermit was released concurrently with the second edition of the manual, "Using C-Kermit", and it is completely described there, with supplementary material found in system-specific publications, such as the Kermit 95 manual. The update files that accompanied edits 189, 190, and 191 are no longer needed. If the release date shown by the VERSION command is long past, be sure to check with the Kermit Project to see if have been updates.Welcome to UNIX C-Kermit communications software for: . Error-free and efficient file transfer . Terminal connection . Script programming . International character set conversion Supporting: . Serial connections, direct or dialed. . Automatic modem dialing While typing commands, you may use the following special characters: . DEL, RUBOUT, BACKSPACE, CTRL-H: Delete the most recent character typed. . CTRL-W: Delete the most recent word typed. . CTRL-U: Delete the current line. . CTRL-R: Redisplay the current line. . CTRL-P: Command recall - go backwards in command recall buffer. . CTRL-B: Command recall - same as Ctrl-P. . CTRL-N: Command recall - go forward in command recall buffer. . ? (question mark) Display a menu for the current command field. . ESC (or TAB) Attempt to complete the current field. . \ (backslash) include the following character literally or introduce a backslash code, variable, or function. Command words other than filenames can be abbreviated in most contexts. Basic C-Kermit commands: EXIT exit from C-Kermit HELP request general help HELP command request help about the given command TAKE execute commands from a file Commands for file transfer: SEND send files RECEIVE receive files GET get files from a Kermit server RESEND recover an interrupted send REGET recover an interrupted get from a server SERVER be a Kermit server Important settings: SET PARITY communications parity SET FLOW communications flow control, such as XON/XOFF SET FILE file settings, for example TYPE TEXT or TYPE BINARY To make a direct serial connection: SET LINE select serial communication device SET SPEED select communication speed CONNECT begin terminal connection To dial out with a modem: SET DIAL DIRECTORY specify dialing directory file (optional) SET DIAL COUNTRY-CODE country you are dialing from (*) SET DIAL AREA-CODE area-code you are dialing from (*) LOOKUP lookup entries in your dialing directory (*) SET MODEM TYPE select modem type SET LINE select serial communication device SET SPEED select communication speed DIAL dial the phone number CONNECT begin terminal connectionFurther info: HELP DIAL, HELP SET MODEM, HELP SET LINE, HELP SET DIAL(*) (For use with optional dialing directory) To return from a terminal connection to the C-Kermit prompt: Type your escape character followed by the letter C. To display your escape character: SHOW ESCAPE To display other settings: SHOW COMMUNICATIONS, SHOW TERMINAL, SHOW FILE, SHOW PROTOCOL, etc. To speed up file transfers: SET RECEIVE PACKET-LENGTH (use bigger packets) SET WINDOW (use sliding windows) SET PREFIXING (reduce prefixing overhead) FAST (combination of the three above) For further information about a particular command, type HELP xxx,where xxx is the name of the command. For documentation, news of newreleases, and information about other Kermit software, contact: The Kermit Project E-mail: kermit-orders@columbia.edu Columbia University Web: http://www.columbia.edu/kermit/ 612 West 115th Street Voice: +1 (212) 854-3703 New York NY 10025-7799 Fax: +1 (212) 663-8202 USASyntax: INPUT { number-of-seconds, time-of-day } [ text ]Example: INPUT 5 Login: or INPUT 23:59:59 RING Waits up to the given number of seconds, or until the given time of dayfor the given text to arrive on the connection. If no text is given, INPUTwaits for any character. For use in script programs with IF FAILURE andIF SUCCESS. Also see MINPUT, REINPUT, SET INPUT. See PAUSE for details ontime-of-day format.Syntax: SET PROTOCOL { KERMIT, XMODEM, YMODEM, ZMODEM } [ s1 s2 s3 s4 s5 s6 ] Selects protocol to use for transferring files. s1 and s2 are commands tooutput prior to SENDing with this protocol, to automatically start theRECEIVE process on the other end in binary or text mode, respectively.s3 and s4 are commands used on this computer for sending files with thisprotocol in binary or text mode. s5 and s6 are the commands for receivingfiles with this protocol. Use "%s" in any of these strings to representthe filename(s). Use { braces } if any command contains spaces. Example: set proto ymodem rb {rb -a} {sb %s} {sb -a %s} rb rb NOTE: This feature requires REDIRECT and external protocols that can beredirected.Syntax: BYE Shut down and log out a remote Kermit serverSyntax: CLOSE nameExample: CLOSE PACKET Close one of the following logs or files: SESSION TRANSACTION PACKET DEBUGGING READ WRITEType HELP LOG and HELP OPEN for further info.Syntax: MINPUT n [ string1 [ string2 [ ... ] ] ]Example: MINPUT 5 Login: {Username: } {NO CARRIER} BUSY RING For use in script programs. Waits up to n seconds for any one of thestrings to arrive on the communication device. If no strings are given, thecommand waits for any character at all to arrive. Strings are separated byspaces; use { braces } for grouping. If any of the strings is encounteredwithin the timeout interval, the command succeeds and the \v(minput)variable is set to the number of the string that was matched: 1, 2, 3, etc.If none of the strings arrives, the command times out, fails, and\v(minput) is set to 0. Also see: INPUT, REINPUT, SET INPUT.Syntax: CONNECT (or C) [/QUIETLY] Connect to a remote computer via the serial communications device given inthe most recent SET LINE command, or to the network host named in the mostrecent SET HOST command. Type the escape character followed by C to getback to the C-Kermit prompt, or followed by ? for a list of CONNECT-modeescape commands. Include the /QUIETLY switch to suppress the informational message thattells you how to escape back, etc.Syntax: GET filespec Tell the remote Kermit server to send the named file or files. If the filespec is omitted, then you are prompted for the remote and local filenames separately.Syntax: LOG (or L) name [ { NEW, APPEND } ]Record information in a log file: DEBUGGING Debugging information, to help track down bugs in the C-Kermit program (default log name is debug.log). PACKETS Kermit packets, to help with protocol problems (packet.log)SESSION Terminal session, during CONNECT command (session.log)TRANSACTIONS Names and statistics about files transferred (transact.log) If you include the APPEND keyword after the filename, the existing log file,if any, is appended to; otherwise a new file is created.Use CLOSE to stop logging.Syntax: SCRIPT text A limited and cryptic "login assistant", carried over from old C-Kermitreleases for comptability, but not recommended for use. Instead, pleaseuse the full script programming language described in chapters 11-13 of"Using C-Kermit". Login to a remote system using the text provided. The login scriptis intended to operate similarly to UNIX uucp "L.sys" entries.A login script is a sequence of the form: expect send [expect send] . . . where 'expect' is a prompt or message to be issued by the remote site, and'send' is the names, numbers, etc, to return. The send may also be thekeyword EOT, to send control-d, or BREAK (or \\b), to send a break signal.Letters in send may be prefixed by ~ to send special characters. These are:~b backspace, ~s space, ~q '?', ~n linefeed, ~r return, ~c don'tappend a return, and ~o[o[o]] for octal of a character. As with someuucp systems, sent strings are followed by ~r unless they end with ~c. Only the last 7 characters in each expect are matched. A null expect,e.g. ~0 or two adjacent dashes, causes a short delay. If you expectthat a sequence might not arrive, as with uucp, conditional sequencesmay be expressed in the form: -send-expect[-send-expect[...]] where dashed sequences are followed as long as previous expects fail.Syntax: RECEIVE (or R) [filespec] Wait for a file to arrive from the other Kermit, which must be given aSEND command. If the optional filespec is given, the (first) incomingfile will be stored under that name, otherwise it will be stored underthe name it arrives with. If the filespec denotes a directory, theincoming file or files will be placed in that directory.Syntax: SEND (or S) filespec [name] Send the file or files specified by filespec. filespec may contain wildcard characters '*' or '?'. If no wildcards, then 'name' may be used to specify the name 'filespec' is sent under; if 'name' is omitted, the file is sent under its own name. Also see ADD.Syntax: RESEND filespec [name] Resend the file or files, whose previous transfer was interrupted. Picks up from where previous transfer left off, IF the receiver was told to SET FILE INCOMPLETE KEEP. Only works for binary-mode transfers. Requires the other Kermit to have RESEND capability.Syntax: REGET filespec Ask a server to RESEND a file to C-Kermit.Syntax: PSEND filespec position [name] Just like SEND, except sends the file starting at the given byte position.Syntax: MSEND filespec [ filespec [ ... ] ] Send the files specified by the filespecs. One or more filespecs may be listed, separated by spaces. Any or all filespecs may contain wildcards and they may be in different directories. An alternate name cannot be given.Syntax: ADD filespec [ [ ] ] Add the file or files to the current SEND list. Use SHOW SEND-LIST and CLEAR SEND-LIST to display and clear the list, use SEND by itself to send it.Syntax: SERVER Enter server mode on the currently selected line. All further commands will be taken in packet form from the other Kermit program. Use FINISH or BYE to get C-Kermit out of server mode.The SET command is used to establish various communication or fileparameters. The SHOW command can be used to display the values ofSET parameters. Help is available for each individual parameter;type HELP SET ? to see what's available.Syntax: SET KEY k textOr: SET KEY CLEAR Configure the key whose "scan code" is k to send the given text whenpressed during CONNECT mode. SET KEY CLEAR restores all the defaultkey mappings. If there is no text, the default key binding is restored forthe key k. To find out the scan code and mapping for a particular key, use theSHOW KEY command.Syntax: SET BLOCK-CHECK type Type of packet block check to be used for error detection, 1, 2, 3, orBLANK-FREE-2. Type 1 is standard, and catches most errors. Types 2 and 3specify more rigorous checking at the cost of higher overhead. TheBLANK-FREE-2 type is the same as Type 2, but is guaranteed to contain noblanks.Syntax: SET CONTROL-CHARACTER { PREFIXED, UNPREFIXED } { ..., ALL } is the numeric ASCII code for a control character 1-31, 127-159, 255.The word "ALL" means the command applies to all characters in this range. PREFIXED means the given control character must be converted to a printable character and prefixed, the default for all control characters. UNPREFIXED means you think it is safe to send the given control character as-is, without a prefix. USE THIS OPTION AT YOUR OWN RISK! SHOW CONTROL to see current settings. SET CONTROL PREFIXED ALL isrecommended for safety. You can include multiple values in onecommand, separated by spaces.Syntax: SET MODEM ... Note: Many of the SET MODEM parameters are configured automatically whenyou SET MODEM TYPE, according to the modem's capabilities. SHOW MODEM tosee them. Also see HELP DIAL and HELP SET DIAL. SET MODEM TYPE Tells Kermit which kind of modem you have, so it can issue the appropriate modem-specific commands for configuration, dialing, and hanging up. For a list of the modem types known to Kermit, type "set modem type ?". Use SET MODEM TYPE NONE (the default) for direct serial connections. Use SET MODEM TYPE USER-DEFINED to use a type of modem that is not built in to Kermit, and then user SET MODEM CAPABILITIES, SET MODEM DIAL-COMMAND, and SET MODEM COMMAND to tell Kermit how to configure and control it. Give the SET MODEM TYPE command BEFORE the SET LINE command so Kermit can open the communications device in the correct mode for dialing. SET MODEM CAPABILITIES Use this command for changing Kermit's idea of your modem's capabilities, for example, if your modem is supposed to have built-in error correction but in fact does not. Also use this command to define the capabilities of a USER-DEFINED modem. Capabilities are: AT AT-commands DC data-compression EC error-correction HWFC hardware-flow ITU v25bis-commands SWFC software-flow KS kermit-spoof SB speed-buffering TB Telebit SET MODEM CARRIER-WATCH { AUTO, ON, OFF } Synonym for SET CARRIER-WATCH (q.v.) SET MODEM COMPRESSION { ON, OFF } Enables/disables the modem's data compression feature, if any. SET MODEM DIAL-COMMAND The text replaces Kermit's built-in modem dialing command. It must include '%s' (percent s) as a place-holder for the telephone numbers given in your DIAL commands. SET MODEM ERROR-CORRECTION { ON, OFF } Enables/disables the modem's error-correction feature, if any. SET MODEM ESCAPE-CHARACTER number Numeric ASCII value of modem's escape character, e.g. 43 for '+'. For Hayes-compatible modems, Kermit uses three copies, e.g. "+++". SET MODEM FLOW-CONTROL {AUTO, NONE, RTS/CTS, XON/XOFF} Selects the type of local flow control to be used by the modem. SET MODEM HANGUP-METHOD { MODEM-COMMAND, RS232-SIGNAL } How hangup operations should be done. MODEM-COMMAND means try to escape back to the modem's command processor and give a modem-specific hangup command. RS232-SIGNAL means turn off the DTR signal. SET MODEM KERMIT-SPOOF {ON, OFF} If the selected modem type supports the Kermit protocol directly, use this command to turn its Kermit protocol function on or off. SET MODEM MAXIMUM-SPEED Specify the maximum interface speed for the modem. SET MODEM NAME Descriptive name for a USER-DEFINED modem. SET MODEM SPEED-MATCHING {ON, OFF} ON means that C-Kermit changes its serial interface speed to agree with the speed reported by the modem's CONNECT message, if any. OFF means Kermit should not change its interface speed. SET MODEM COMMAND commands are used to override built-in modem commands foreach modem type, or to fill in commands for the USER-DEFINED modem type.Omitting the optional [ text ] restores the built-in modem-specific command,if any: SET MODEM COMMAND AUTOANSWER {ON, OFF} [ text ] Modem commands to turn autoanswer on and off. SET MODEM COMMAND COMPRESSION {ON, OFF} [ text ] Modem commands to turn data compression on and off. SET MODEM COMMAND ERROR-CORRECTION {ON, OFF} [ text ] Modem commands to turn error correction on and off. SET MODEM COMMAND HANGUP [ text ] Command that tells the modem to hang up the connection. SET MODEM COMMAND INIT-STRING [ text ] The 'text' is a replacement for C-Kermit's built-in initialization command for the modem. SET MODEM COMMAND HARDWARE-FLOW [ text ] Modem command to enable hardware flow control (RTS/CTS) in the modem. SET MODEM COMMAND SOFTWARE-FLOW [ text ] Modem command to enable local software flow control (Xon/Xoff) in modem. SET MODEM COMMAND NO-FLOW-CONTROL [ text ] Modem command to disable local flow control in the modem. SET MODEM COMMAND PULSE [ text ] Modem command to select pulse dialing. SET MODEM COMMAND TONE [ text ] Modem command to select tone dialing. The SET DIAL command establishes or changes all parameters related todialing the telephone. Also see HELP DIAL and HELP SET MODEM. Use SHOWDIAL to display all of the SET DIAL values. SET DIAL COUNTRY-CODE Tells Kermit the telephonic country-code of the country you are dialing from, so it can tell whether a portable-format phone number from your dialing directory will result in a national or an international call. Examples: 1 for USA, Canada, Puerto Rico, etc; 7 for Russia, 39 for Italy, 351 for Portugal, 47 for Norway, 44 for the UK, 972 for Israel, 81 for Japan, ... If you have not already set your DIAL INTL-PREFIX and LD-PREFIX, then this command sets default values for them: 011 and 1, respectively, for country code 1; 00 and 0, respectively, for all other country codes. If these are not your true international and long-distance dialing prefixes, then you should follow this command by DIAL INTL-PREFIX and LD-PREFIX to let Kermit know what they really are. SET DIAL AREA-CODE [ ] Tells Kermit the area or city code that you are dialing from, so it can tell whether a portable-format phone number from the dialing directory is local or long distance. Be careful not to include your long-distance dialing prefix as part of your area code; for example, the area code for central London is 171, not 0171. SET DIAL CONFIRMATION {ON, OFF} Kermit does various transformations on a telephone number retrieved from the dialing directory prior to dialing (use LOOKUP to see them). In case the result might be wrong, you can use SET DIAL CONFIRM ON to have Kermit ask you if it is OK to dial the number, and if not, to let you type in a replacement. SET DIAL CONNECT { AUTO, ON, OFF } Whether to CONNECT (enter terminal mode) automatically after successfully dialing. ON means to do this; OFF means not to. AUTO (the default) means do it if the DIAL command was given interactively, but don't do it if the DIAL command was issued from a macro or command file. If you specify ON or AUTO, you may follow this by one of the keywords VERBOSE or QUIET, to indicate whether the verbose 4-line 'Connecting...' message is to be displayed if DIAL succeeds and Kermit goes into CONNECT mode. SET DIAL CONVERT-DIRECTORY {ASK, ON, OFF} The format of Kermit's dialing directory changed in version 5A(192). This command tells Kermit what to do when it encounters an old-style directory: ASK you whether to convert it, or convert it automatically (ON), or leave it alone (OFF). Old-style directories can still be used without conversion, but the parity and speed fields are ignored. SET DIAL DIRECTORY [ filename [ filename [ filename [ ... ] ] ] ] The name(s) of your dialing directory file(s). If you do not supply any filenames, the dialing directory feature is disabled and all numbers are dialed literally as given in the DIAL command. If you supply more than one directory, all of them are searched. SET DIAL SORT {ON, OFF} When multiple entries are obtained from your dialing directory, they are sorted in "cheapest-first" order. If this does not produce the desired effect, SET DIAL SORT OFF to disable sorting, and the numbers will be dialed in the order in which they were found. SET DIAL DISPLAY {ON, OFF} Whether to display dialing progress on the screen; default is OFF. SET DIAL HANGUP {ON, OFF} Whether to hang up the phone prior to dialing; default is ON. SET DIAL METHOD {DEFAULT, TONE, PULSE} Whether to use the modem's DEFAULT dialing method, or to force TONE or PULSE dialing. SET DIAL TIMEOUT number How many seconds to wait for a dialed call to complete. Use this command to override the DIAL command's automatic timeout calculation. A value of 0 turns off this feature and returns to Kermit's automatic dial timeout calculation. SET DIAL RESTRICT { INTERNATIONAL, LOCAL, LONG-DISTANCE, NONE } Prevents placing calls of the type indicated, or greater. For example SET DIAL RESTRICT LONG prevents placing of long-distance and international calls. If this command is not given, there are no restrictions. SET DIAL RETRIES How many times to redial each number if the dialing result is busy or no no answer, until the call is succesfully answered. The default is 0 because automatic redialing is illegal in some countries. SET DIAL INTERVAL How many seconds to pause between automatic redial attempts; default 10. The following commands apply to all phone numbers, whether given literallyor found in the dialing directory: SET DIAL PREFIX [ text ] Establish a prefix to be applied to all phone numbers that are dialed, for example to disable call waiting. SET DIAL SUFFIX [ text ] Establish a suffix to be added after all phone numbers that are dialed. The following commands apply only to portable-format numbers obtained fromthe dialing directory; i.e. numbers that start with a "+" sign andcountry code, followed by area code in parentheses, followed by the phonenumber. SET DIAL LD-PREFIX [ ] Your long-distance dialing prefix, to be used with portable dialing directory entries that result in long-distance calls. SET DIAL LD-SUFFIX [ ] Long-distance dialing suffix, if any, to be used with portable dialing directory entries that result in long-distance calls. This would normally be used for appending a calling-card number to the phone number. SET DIAL TOLL-FREE-AREA-CODE [ [ [ ... ] ] ] Tells Kermit the toll-free area code(s) in your country. SET DIAL TOLL-FREE-PREFIX [ ] You toll-free dialing prefix, in case it is different from your long- distance dialing prefix. SET DIAL INTL-PREFIX Your international dialing prefix, to be used with portable dialing directory entries that result in international calls. SET DIAL INTL-SUFFIX International dialing suffix, if any, to be used with portable dialing directory entries that result in international calls. SET DIAL PBX-OUTSIDE-PREFIX Use this to tell Kermit how to get an outside line when dialing from a Private Branch Exchange (PBX). SET DIAL PBX-EXCHANGE If PBX-OUTSIDE-PREFIX is set, then you can use this command to tell Kermit the leading digits of a local phone number that identify it as being on your PBX, so it can make an internal call by deleting those digits from the phone number. SET DIAL PBX-INTERNAL-PREFIX If PBX-EXCHANGE is set, and Kermit determines from it that a call is internal, then this prefix, if any, is added to the number prior to dialing. Use this if internal calls require a special prefix.Syntax: SET FLOW value Type of flow control to use during file transfer and CONNECT mode.Choices: AUTOMATIC (the default, let Kermit choose for you); KEEP (don'tchange the device's current setting), XON/XOFF (software flow control),NONE (no flow control at all), and possibly others including RTS/CTS(hardware) depending on the capabilities of your computer and operatingsystem. Type SET FLOW ? for a list.Syntax: SET FILE parameter valueParameters: BYTESIZE { 7, 8 }: normally 8. If 7, truncate the 8th bit of all file bytes. COLLISION tells what to do when a file arrives that has the same name asan existing file. The options are: BACKUP (default) - Rename the old file to a new, unique name and store the incoming file under the name it was sent with. OVERWRITE - Overwrite (replace) the existing file. APPEND - Append the incoming file to the end of the existing file. DISCARD - Refuse and/or discard the incoming file. RENAME - Give the incoming file a unique name. UPDATE - Accept the incoming file only if it is newer than the existing file.Example: SET FILE COLLISION UPDATE SET FILE DISPLAY selects the format of the file transfer display forlocal-mode file transfer. The choices are: SERIAL (the default). One dot is printed for every K bytes transferred. This format works on any kind of terminal, even a hardcopy. CRT. Numbers are continuously updated on a single screen line. This format can be used on any video display terminal. NONE. No file transfer display at all. DOWNLOAD-DIRECTORY [ ]Directory into which all received files should be placed. By default,received files go into your current directory. INCOMPLETE - what to do with an incompletely received file: KEEP(default), or DISCARD. NAMES are normally CONVERTED to 'common form' during transmission; LITERALmeans use filenames literally (useful between like systems). Also seeSET SEND PATHNAMES and SET RECEIVE PATHNAMES. TYPE: How file contents are to be treated during file transfer.TYPE is normally TEXT, with conversion of record format and character set.BINARY means to do no conversion. Use BINARY for executable programs orbinary data. Example: SET FILE TYPE BINARY. WARNING. SET FILE WARNING is superseded by the newer command, SET FILECOLLISION. SET FILE WARNING ON is equivalent to SET FILE COLLISION RENAMEand SET FILE WARNING OFF is equivalent to SET FILE COLLISION OVERWRITE. Syntax: SET HANDSHAKE value Character to use for half duplex line turnaround handshake during filetransfer. C-Kermit waits for this character from the other computer beforesending its next packet. Default is NONE, others are XON, LF, BELL, ESC,etc. SET HANDSHAKE CODE lets you specify the numeric ASCII value of thehandshake character. Type SET HANDSH ? for a list.SET SERVER DISPLAY {ON,OFF}Tell whether local-mode C-Kermit during server operation should put afile transfer display on the screen. Default is OFF. SET SERVER GET-PATH [ directory [ directory [ ... ] ] ]Tells the C-Kermit server where to search for files whose names it receivesfrom client GET commands when the names are not fully specified pathnames.Default is no GET-PATH, so C-Kermit looks only in its current directory. SET SERVER IDLE-TIMEOUT secondsIdle time limit while in server mode, 0 for no limit. SET SERVER LOGIN [ username [ password [ account ] ] ]Sets up a username and optional password which must be supplied beforethe server will respond to any commands other than REMOTE LOGIN. Theaccount is ignored. If you enter SET SERVER LOGIN by itself, then loginis no longer required. SET SERVER TIMEOUT nServer command wait timeout interval, how often the C-Kermit server issuesa NAK while waiting for a command packet. Specify 0 for no NAKs at all.Default is 0.The REMOTE command is used to send file management instructions to aremote Kermit server. There should already be a Kermit running in servermode on the other end of the currently selected line. Type REMOTE ? tosee a list of available remote commands. Type HELP REMOTE x to getfurther information about a particular remote command 'x'.Syntax: IF [NOT] condition command If the condition is (is not) true, do the command. Only one command maybe given, and it must appear on the same line as the IF. Conditions are: SUCCESS - the previous command succeeded FAILURE - the previous command failed BACKGROUND - C-Kermit is running in the background FOREGROUND - C-Kermit is running in the foreground REMOTE-ONLY - C-Kermit was started with the -R command-line option DEFINED variablename or macroname - The named variable or macro is defined DIRECTORY string - The string is the name of a directory NEWER file1 file2 - The 1st file is newer than the 2nd one NUMERIC variable or constant - The variable or constant is numeric EXIST filename - The named file exists COUNT - subtract one from COUNT, execute the command if the result is greater than zero (see SET COUNT) EQUAL s1 s2 - s1 and s2 (character strings or variables) are equal LLT s1 s2 - s1 is lexically (alphabetically) less than s2 LGT s1 s1 - s1 is lexically (alphabetically) greater than s2 = n1 n2 - n1 and n2 (numbers or variables containing numbers) are equal < n1 n2 - n1 is arithmetically less than n2 > n1 n2 - n1 is arithmetically greater than n2 The IF command may be followed on the next line by an ELSE command. Example: IF < \%x 10 ECHO It's less ELSE echo It's not less See also XIF.Syntax: EVALUATE expression Evaluate an integer arithmetic expression and print its value. Theexpression can contain numbers and/or numeric-valued variables or functions.Operators include +-/*(), etc. Example: EVAL (1+1) * (\%a / 3).Syntax: XIF condition { commandlist } [ ELSE { commandlist } ] Extended IF command. The conditions are the same as for IF (type HELP IF)but multiple comma-separated commands may be grouped within braces in boththe IF and ELSE parts. The ELSE part, if any, must be on the same line asthe XIF (or use dash for line continuation). Example: XIF equal \%a YES { echo OK, goto begin } ELSE { echo Not OK, stop }Syntax: FOR variablename initial-value final-value increment { commandlist } FOR loop. Execute the comma-separated commands in the commandlist thenumber of times given by the initial value, final value and increment.Example: FOR \%i 10 1 -1 { pause 1, echo \%i }Syntax: WHILE condition { commandlist } WHILE loop. Execute the comma-separated commands in the bracketedcommandlist while the condition is true. Conditions are the same as forIF commands.Syntax: SWITCH { case-list }The case-list is a series of lines like these: :x, command, command, ..., break where "x" is a possible value for the variable. At the end of thecase-list, you can put a "default" label to catch when the variable doesnot match any of the labels: :default, command, command, ...Syntax: OPEN mode filename For use with READ and WRITE commands. Open the local file in the specifiedmode: READ, WRITE, or APPEND. !READ and !WRITE mean to read from or writeto a system command rather than a file. Examples: OPEN READ oofa.txt OPEN !READ sort foo.barSyntax: ASKQ variablename [ prompt ]Example: ASKQ \%p { Password:} Issues the prompt and defines the variable to be whatever you type in.The characters that you type do not echo on the screen.Use braces to preserve leading and/or trailing spaces in the prompt.To include a question mark, precede it by backslash (\).Syntax: ASK variablename [ prompt ]Example: ASK \%n { What is your name\? } Issues the prompt and defines the variable to be whatever you type in.Use braces to preserve leading and/or trailing spaces in the prompt.To include a question mark, precede it by backslash (\).Syntax: GETC variablename [ prompt ]Example: GETC \%c { Type any character to continue...} Issues the prompt and sets the variable to the first character you type.Use braces to preserve leading and/or trailing spaces in the prompt.Syntax: DEFINE name [ definition ] Defines a macro or variable. Its value is the definition, taken literally.No expansion or evaluation of the definition is done. Thus if thedefinition includes any variable or function references, their names areincluded, rather than their values (compare with ASSIGN). If the definitionis omitted, then the named variable or macro is undefined. A typical macro definition looks like this: DEFINE name command, command, command, ... for example: DEFINE vax set parity even, set duplex full, set flow xon/xoff which defines a Kermit command macro called 'vax'. The definition is acomma-separated list of Kermit commands. Use the DO command to executethe macro, or just type its name, followed optionally by arguments. The definition of a variable can be anything at all, for example: DEFINE \%a Monday DEFINE \%b 3 These variables can be used almost anywhere, for example: ECHO Today is \%a SET BLOCK-CHECK \%bSyntax: ASSIGN variablename string.Example: ASSIGN \%a My name is \%b. Assigns the current value of the string to the variable (or macro).The definition string is fully evaluated before it is assigned, so thatthe values of any variables are contained are used, rather than theirnames. Compare with DEFINE. To illustrate the difference, try this: DEFINE \%a hello DEFINE \%x \%a ASSIGN \%y \%a DEFINE \%a goodbye ECHO \%x \%y This will print 'goodbye hello'.Syntax: DECREMENT variablename [ number ] Decrement (subtract one from) the value of a variable if the current valueis numeric. If the number argument is given, subtract that number instead. Examples: DECR \%a, DECR \%a 7, DECR \%a \%nSyntax: INCREMENT variablename [ number ] Increment (add one to) the value of a variable if the current value isnumeric. If the number argument is given, add that number instead. Examples: INCR \%a, INCR \%a 7, INCR \%a \%nSyntax: SET EXIT ON-DISCONNECT { ON, OFF } When ON, C-Kermit EXITs automatically when a network connection is terminated either by the host or by issuing a HANGUP command. This command is not currently supported on serial connections. Syntax: SET EXIT STATUS number Set C-Kermit's program return code to the given number, which can be a constant, variable, or an \feval() expression. Syntax: SET EXIT WARNING { ON, OFF, ALWAYS } When EXIT WARNING is ON, issue a warning message and ask for confirmation before EXITing if a connection to another computer might still be open. When EXIT WARNING is ALWAYS, confirmation is always requested. The default is ON.Syntax: PAUSE [ { number-of-seconds, hh:mm:ss } ]Example: PAUSE 3 or PAUSE 14:52:30 Do nothing for the specified number of seconds or until the given time ofday in 24-hour hh:mm:ss notation. If the time of day is earlier than thecurrent time, it is assumed to be tomorrow. If no argument given, onesecond is used. The pause can be interrupted by typing any character on thekeyboard. If interrupted, PAUSE fails, otherwise it succeeds.Synonym: SLEEP.Syntax: MSLEEP [ number ]Example: MSLEEP 500 Do nothing for the specified number of milliseconds; if no number given,100 milliseconds.Syntax: ! [ command ] or RUN [ command ] or PUSH [ command ] Give a command to the local operating system's command processor, anddisplay the results on the screen. If the command is omitted, enter interactive mode; return to Kermitby exiting from the system's command parser. The command is usuallyEXIT or QUIT or LOGOUT.Syntax: TRANSMIT file The TRANSMIT command is used for sending single files to other computersthat don't have Kermit. Text files are sent a line at a time; binary filesare sent a character at a time. There is no guarantee that the othercomputer will receive the file correctly and completely. Before you startthe TRANSMIT command, you must put the other computer in data collectionmode, for example by starting a text editor. TRANSMIT may be interrupted byCtrl-C. Synonym: XMIT.Syntax: WAIT { number-of-seconds, hh:mm:ss } [modem-signal(s)]Example: WAIT 5 \cd \ctsOr: WAIT 23:59:59 \cdWaits up to the given number of seconds or the given time of day for all ofthe specified modem signals to appear on the serial communication device.Sets FAILURE if signals do not appear in the given time or if interrupted bytyping anything at the keyboard during the waiting period. Signals: \cd = Carrier Detect, \dsr = Dataset Ready, \cts = Clear To SendSyntax: WRITE name text Writes the given text to the named log or file. The text text may includebackslash codes, and is not terminated by a newline unless you include theappropriate code. The name parameter can be any of the following: DEBUG-LOG ERROR (standard error) FILE (the OPEN WRITE, OPEN !WRITE, or OPEN APPEND file, see HELP OPEN) PACKET-LOG SCREEN (compare with ECHO) SESSION-LOG TRANSACTION-LOGSyntax: LOOKUP name Looks up the given name in the dialing directory or directories, if any,specified in the most recent SET DIAL DIRECTORY command. Each matchingentry is shown, along with any transformations that would be applied toportable-format entries based on your locale. HELP DIAL, HELP SET DIALfor further info.Syntax: ANSWER [ ] Waits for a modem call to come in. Prior SET MODEM TYPE and SET LINErequired. If is 0 or not specified, Kermit waits forever or untilinterrupted, otherwise Kermit waits the given number of seconds. The ANSWERcommand puts the modem in autoanswer mode. Subsequent DIAL commands willautomatically put it (back) in originate mode. SHOW MODEM, HELP SET MODEMfor more info.Syntax: DIAL phonenumberExample: DIAL 7654321 Dials a number using an autodial modem. First you must SET MODEM, thenSET LINE, then SET SPEED. Then give the DIAL command, including the phonenumber, for example: DIAL 7654321 See also SET DIAL, SET MODEM, SET LINE, SET SPEED, REDIAL. If the phonenumber starts with a letter, and if you have used the SET DIALDIRECTORY command to specify one or more dialing-directory files, Kermitlooks it up in the given file(s); if it is found, the name is replaced bythe number or numbers associated with the name. If it is not found, thename is sent to the modem literally. If the phonenumber starts with an equals sign ("="), this forces the partafter the = to be send literally to the modem, even if it starts with aletter, without any directory lookup. A dialing directory is a plain text file, one entry per line: name phonenumber ; comments for example: work 9876543 ; This is a comment e-mail +1 (212) 555 4321 ; My electronic mailbox heise +49 (511) 535 2301 ; Verlag Heinz Heise BBS If a phone number starts with +, then it must include country code andarea code, and C-Kermit will try to handle these appropriately based onthe current locale (HELP SET DIAL for further info); these are calledPORTABLE entries. If it does not start with +, it is dialed literally. If more than one entry is found with the same name, Kermit dials all ofthem until the call is completed; if the entries are in portable format,Kermit dials then in cheap-to-expensive order: internal, then local, thenlong-distance, then international, based on its knowledge of your localcountry code and area code (see HELP SET DIAL). Specify your dialing directory file(s) with the SET DIAL DIRECTORY command.Syntax: SET TRANSMIT parameter value Controls the behavior of the TRANSMIT command, used for uploading filesto computers that don't have Kermit programs. Parameters are: ECHO ON/OFF: Whether to echo text as it is being transmitted.EOF text: Text to send after end of file is reached.FILL number: ASCII value of character to insert into blank lines.LINEFEED ON/OFF: Transmit LF as well as CR at the end of each line. Normally, only CR is sent.LOCKING-SHIFT ON/OFF: Whether to use SO/SI for transmitting 8-bit data when PARITY is not NONE.PAUSE number: How many milliseconds to pause after transmitting each line (text mode), or each character (binary mode).PROMPT number: ASCII value of character to look for from host before sending next line, normally LF (10).Synonym: SET XMIT.Syntax: SET BACKGROUND { OFF, ON } SET BACKGROUND OFF forces prompts and messages to appear on your screeneven though Kermit thinks it is running in the background.Syntax: SET BUFFERS n1 [ n2 ] Change the overall amount of memory allocated for SEND and RECEIVE packetbuffers, respectively. Bigger numbers let you have longer packets and morewindow slots. If n2 is omitted, the same value as n1 is used.Syntax: SET COMMAND parameter value SET COMMAND BYTESIZE { 7, 8 } Informs C-Kermit of the bytesize of the communication path between itself and your keyboard and screen. 7 is assumed. SET COMMAND BYTE 8 to allow entry and display of 8-bit characters. SET COMMAND HEIGHT Informs C-Kermit of the number of rows in your command screen for the purposes of More?-prompting. SET COMMAND WIDTH Informs C-Kermit of the number of characters across your screen for purposes of screen formatting. SET COMMAND MORE-PROMPTING { ON, OFF } ON (the default) enables More?-prompting when C-Kermit needs to display text that does not fit vertically on your screen. OFF allows the text to scroll by without intervention. If your command window has scroll bars, you might prefer OFF. SET COMMAND RECALL-BUFFER-SIZE number How big you want C-Kermit's command recall buffer to be. By default, it holds 10 commands. You can make it any size you like, subject to memory constraints of the computer. A size of 0 disables command recall. Whenever you give this command, previous command history is lost. SET COMMAND QUOTING { ON, OFF } Whether to treat backslash and question mark as special characters (ON), or as ordinary data characters (OFF) in commands. ON by default. SET COMMAND RETRY { ON, OFF } Whether to reprompt you with the correct but incomplete portion of a syntactically incorrect command. ON by default. Use SHOW COMMAND to display these settings.Syntax: SET CARRIER ON, AUTO, or OFF Attempts to control treatment of carrier on the communication device.ON means that carrier is required at all times except during the DIALcommand. OFF means that carrier is never required. AUTO (the default)means that carrier is required only during CONNECT.Syntax: SET ATTRIBUTES name ON or OFF Use this command to enable (ON) or disable (OFF) the transmission ofselected file attributes along with each file, and to handle or ignoreselected incoming file attributes, including: DATE: The file's creation date DISPOSITION: Unusual things to do with the file, like MAIL or PRINT LENGTH: The file's length SYSTEM-ID: Machine/Operating system of origin TYPE: The file's type (text or binary) You can also specify ALL to select all of them. Examples: SET ATTR DATE OFF SET ATTR LENGTH ON SET ATTR ALL OFFSyntax: SET INPUT parameter value The SET INPUT command controls the behavior of the INPUT command: SET INPUT BUFFER-LENGTH number-of-bytesRemoves the old INPUT buffer and creates a new one with the given length. SET INPUT CASE { IGNORE, OBSERVE }Tells whether alphabetic case is to be significant in string comparisons.This setting is local to the current macro or command file, and is inheritedby subordinate macros and take files. SET INPUT ECHO { ON, OFF }Tells whether to display arriving characters read by INPUT on the screen. SET INPUT SILENCE The maximum number to seconds of silence (no input at all) before the INPUTcommand times out, 0 for no maximum. SET INPUT TIMEOUT-ACTION { PROCEED, QUIT }Tells whether to proceed or quit from a script program if an INPUT commandfails. PROCEED (default) allows use of IF SUCCESS and IF FAILURE commands.This setting is local to the current macro or command file, and is inheritedby subordinate macros and take files.Syntax: SET TAKE parameter value Controls behavior of TAKE command. SET TAKE ECHO { ON, OFF } tells whether commands read from a TAKE fileshould be displayed on the screen. SET TAKE ERROR { ON, OFF } tells whether a TAKE command file should beautomatically terminated when a command fails. This setting is local tothe current command file, and inherited by subordinate command files.Syntax: SET TERMINAL parameter value SET TERMINAL TYPE ...This command is not available because this version of C-Kermit does notinclude a terminal emulator. Instead, it is a "semitransparent pipe"(or a totally transparent one, if you configure it that way) to the computeror service you have made a connection to. Your console, workstation window,or the terminal emulator or terminal from which you are running C-Kermitprovides the emulation. SET TERMINAL APC { ON, OFF, UNCHECKED }controls execution of Application Program Commands sent by the host whileC-Kermit is in CONNECT mode. ON allows execution of "safe" commands anddisallows potentially dangerous commands such as DELETE, RENAME, OUTPUT, andRUN. OFF prevents execution of APCs. UNCHECKED allows execution of allAPCs. OFF is the default. SET TERMINAL AUTODOWNLOAD { ON, OFF }enables/disables automatic switching into file-transfer mode when a validKermit or ZMODEM packet of the appropriate type is received during CONNECTmode. Default is OFF. SET TERMINAL BYTESIZE 7 or 8, to use 7- or 8-bit terminal charactersbetween C-Kermit and the remote computer or service during CONNECT. SET TERMINAL CR-DISPLAY { CRLF, NORMAL } to specify how incomingcarriage return characters are to be displayed on your screen. SET TERMINAL DEBUG { ON, OFF } controls terminal session debugging. SET TERMINAL ECHO { LOCAL, REMOTE } specifies which side does the echoingduring terminal connection. SET TERMINAL ESCAPE-CHARACTER { ENABLED, DISABLED } turns on/off the abilityto escape back from CONNECT mode using the SET ESCAPE character.If you disable it, Kermit returns to its prompt only if the connection isclosed by the other end. USE WITH EXTREME CAUTION. SET TERMINAL HEIGHT tells C-Kermit how many rows (lines) are onyour CONNECT-mode screen. SET TERMINAL LOCKING-SHIFT { OFF, ON } tells C-Kermit whether to useShift-In/Shift-Out (Ctrl-O and Ctrl-N) to switch between 7-bit and 8-bitcharacters during CONNECT. OFF by default. SET TERMINAL NEWLINE-MODE { OFF, ON } tells whether to send CRLF when youtype CR during CONNECT mode. SET TERMINAL WIDTH tells C-Kermit how many columns (characters) areon your CONNECT-mode screen. Type SHOW TERMINAL to see current terminal settings.Syntax: SET MACRO parameter value Controls the behavior of macros. SET MACRO ECHO { ON, OFF } tells whether commands executed from a macrodefinition should be displayed on the screen. SET MACRO ERROR { ON, OFF } tells whether a macro should be automaticallyterminated upon a command error. This setting is local to the currentmacro, and inherited by subordinate macros.Syntax: SET PROMPT [ text ] Prompt text for this program, normally 'C-Kermit>'. May contain backslashcodes for special effects. Surround by { } to preserve leading or trailingspaces. If text omitted, prompt reverts to C-Kermit>. Prompt can includevariables like \v(dir) or \v(time) to show current directory or time.Syntax: SET WINDOW-SIZE number Specify number of window slots for sliding windows, the number of packetsthat can be transmitted before pausing for acknowledgement. The defaultis one, the maximum is 32. Increased window size may result in reducedmaximum packet length. Use sliding windows for improved efficiency onconnections with long delays. A full duplex connection is required, as wellas a cooperating Kermit on the other end.Syntax: SET REPEAT { COUNTS { ON, OFF }, PREFIX } SET REPEAT COUNTS turns the repeat-count compression mechanism ON and OFF. The default is ON.SET REPEAT PREFIX sets the repeat-count prefix character to the given code. The default is 126 (tilde).Syntax: SET RECEIVE parameter value Specify parameters for inbound packets: CONTROL-PREFIX number ASCII value of prefix character used for quoting control characters in packets that C-Kermit receives, normally 35 (number sign). Don't change this unless something is wrong with the other Kermit program.END-OF-PACKET number ASCII value of control character that terminates incoming packets, normally 13 (carriage return).PACKET-LENGTH number Maximum length packet the other Kermit should send.PADDING number Number of prepacket padding characters to ask for (normally 0).PAD-CHARACTER number ASCII value of control character to use for padding (normally 0).PATHNAMES ON or OFF If a recognizable path (directory, device, etc) specification appears in an incoming filename, leave it ON and try to use it, or strip it OFF before trying to create the output file. When ON (the default), then if any of the directories in the path don't exist, C-Kermit tries to create them.PAUSE number Milliseconds to pause in between packets, normally 0.START-OF-PACKET number ASCII value of character that marks start of inbound packet.TIMEOUT number Number of seconds the other Kermit should wait for a packet before sending a NAK or retransmitting.Syntax: SET SEND parameter value Specify parameters for outbound packets. This command should be used onlyto override the normal negotiated parameters and is rarely needed: CONTROL-PREFIX number ASCII value of prefix character used for quoting control characters in packets that C-Kermit sends, normally 35 (number sign).END-OF-PACKET number ASCII value of control character to terminate an outbound packet, normally 13 (carriage return).PACKET-LENGTH number Maximum length packet to send, even if other Kermit asks for longer ones.PADDING number Number of prepacket padding characters to send.PAD-CHARACTER number ASCII value of control character to use for padding.PATHNAMES ON or OFF When FILE NAMES is set to LITERAL, leave the path (device, directory, etc) portion ON or OFF the file name when sending it. Applies to the actual filename, not the "as-name". The default is ON.PAUSE number Milliseconds to pause in between packets, normally 0.START-OF-PACKET number ASCII value of character to mark start of outbound packet.TIMEOUT number Number of seconds to wait for a packet before sending NAK or retransmitting. Include the word DYNAMIC after the number in the SET SEND TIMEOUT command to have Kermit compute the timeouts dynamically throughout the transfer based on the packet rate. Include the word FIXED to use the "number" given throughout the transfer. DYNAMIC is the default. After DYNAMIC you may include minimum and maximum values.Synonym: SET XFER Syntax: SET TRANSFER CANCELLATION { OFF, ON [ [ ] ] } OFF disables remote-mode packet-mode cancellation from the keyboard.ON enables it. The optional is the control character to use forcancellation; the optional is how many consecutive occurrencesof the given control character are required for cancellation. Syntax: SET TRANSFER CRC-CALCULATION { OFF, ON } Tells whether C-Kermit should accumulate a Cyclic Redundancy Check for eachfile transfer. Normally ON, in which case the CRC value is available in the\v(crc16) variable after the transfer. Adds a little bit of overhead. UseSET TRANSFER CRC OFF to disable. Syntax: SET TRANSFER LOCKING-SHIFT { OFF, ON, FORCED } Tell whether locking-shift protocol should be used during file transferto achieve 8-bit transparency on a 7-bit connection. ON means to requestits use if PARITY is not NONE and to use it if the other Kermit agrees,OFF means not to use it, FORCED means to use it even if the other Kermitdoes not agree. Syntax: SET TRANSFER MODE { AUTOMATIC, MANUAL } Automatic (the default) means C-Kermit should automatically go into binaryfile-transfer mode and use literal filenames if the other Kermit says it hasa compatible file system, e.g. UNIX-to-UNIX, but not UNIX-to-DOS. Syntax: SET TRANSFER PROTOCOL { KERMIT, XMODEM, ... } Synonym for SET PROTOCOL (q.v.). Syntax: SET TRANSFER SLOW-START { OFF, ON } ON (the default) tells C-Kermit, when sending files, to gradually build upthe packet length to the maximum negotiated length. OFF means start sendingthe maximum length right away.Syntax: REMOTE SET parameter valueExample: REMOTE SET FILE TYPE BINARY Ask the remote Kermit server to set the named parameter to the given value.Equivalent to typing the corresponding SET command directly to the otherKermit if it were in interactive mode.Ƴѳسڳܳ޳ "$ (x-17;@DhIOTW<[`cxkpuz  Ĵϴմڴ      !'.3AGUZ^ber õе ޵ *-0A O TXehk@y@̶)Զ  #4AHQT`lx  ͷ!ڷ"# *%+2$9A&N'X&l'*}  ˸ ܸ & ,: ? DIQZbhmtzemos¹Ź˹Ϲҹٹ $ 3;NTZbkqy~ʺ˺պܺ $7>CNZ`gnv{ƻǻ̻Իۻݻ\v(home)Names of one or more directory files, separated by spacesDirectory name?Wildcards not allowed ?Not a directory - %s parsdir s?Internal error - malloc parsdir pp[dd] 1parsdir myindexparsdir pp[dd] 2?Too many directories - %d max username"%s" - too long, %d max password"%s" - too long, %d max account"%s" - too long, %d max autoCarrier wait timeout, seconds0 Please respond Yes or No push push%s available not CHECK: push not available %s%s available not CHECK: %s not available initmdm mdmtypinitmdm usermdminitmdm pWARNING: modem info for "%s" not filled in yet This space available (use SET MODEM NAME)modem parametersetmodem cmkeyxatmbufsetmodem cmflgs?Ambiguous modem type - %s ?"%s" does not match a keyword or modem type how to hang up modemmodem-commandcapability of modem?value required modem typenonebased on existing modem typeunknownDescriptive name for modemUnexpected SET MODEM parameter Modem initialization stringTelephone number prefixDialing command for modem, include "%s" to stand for phone number, for example, "set dial dial-command ATDT%s\13"?Dial-command must contain "%cs" for phone number. Seconds to wait for call completion0Kermit/modem timeout differential10ASCII value of character to escape back to modem43onModem's command to %sable %sendiscompressionerror-correctionautoanswerModem's hangup commandModem's command to enable hardware flow controlModem's initialization stringModem's command to disable local flow controlTelephone number prefix for dialingModem's command to enable local software flow controlCommand to configure modem for tone dialingCommand to configure modem for pulse dialingCommand to enter dial modeModem response upon entering dial mode?Unexpected SET DIAL STRING parameter autodefaultNumber of times to try dialing a number1Seconds to wait between redial attempts30Area code you are calling from?Sorry, area code must be numeric (please omit the parentheses) (no slashes, please) askCountry code you are calling from?Sorry, country code must be numeric (please omit the plus sign) 110118008881358199610119990000International dialing prefixInternational dialing suffixLong-distance dialing prefixLong-distance dialing suffixExchange of PBX you are calling fromInternal-call prefix of PBX you are calling fromOutside-line prefix of PBX you are calling from Telephone number suffix for dialingToll-free area code in the country you are calling from Long-distance prefix for toll-free dialingautoverbosenone?Unexpected SET DIAL parameter %s Modem carrier-watch: off on auto unknown Modem capabilities: (none) AT ITU SB EC DC HWFC SWFC KS TB Modem maximum-speed: %ld bps (unknown) Modem error-correction: %s onoff Modem compression: %s onoff Modem speed-matching: %sonoff (interface speed %s) changesis locked Modem flow-control: none xon/xoff rts/cts auto Modem kermit-spoof: %s onoff Modem escape-character: %d (= "%c") MODEM COMMANDs (* = set automatically by SET MODEM TYPE): %c Init-string: %c Dial-mode-string: %c Dial-mode-prompt: %c Dial-command: %c Compression on: %c Compression off: %c Error-correction on: %c Error-correction off: %c Autoanswer on: %c Autoanswer off: %c Hangup-command: %c Hardware-flow: %c Software-flow: %c No-flow-control: %c Pulse: %c Tone: For more info: SHOW DIAL and SHOW COMMUNICATIONS Modem info for "%s" not filled in yet No modem selected, so DIAL and most SET MODEM commands have no effect. Use SET MODEM TYPE to select a modem. setalarm xx%ld - illegal value, must be 0 or positive \v(ndate)Internal date error, sorry. \v(ntime)Internal time error, sorry. SET ALARM date (1)SET ALARM time (1)Internal time conversion error, sorry. %04d%02d%02d%ldSET ALARM date (2)SET ALARM time (2)numeric key code, or the word CLEAR,SET KEYclear Press key to be defined: ?Error reading key ?key code must be between 0 and %d Sorry, %d is the CONNECT-mode escape character Enter new definition: key definition, or Ctrl-C to cancel this command, or Enter to restore default definition?Key definition too long {%s}?Sorry - maximum length is %d kermit?Sorry, REDIRECT capability required for external protocols. Optional command to send to host prior to uploading in binary modeOptional command to send to host prior to uploading in text modeExternal command to SEND in BINARY mode with this protocolExternal command to SEND in TEXT mode with this protocolExternal command to RECEIVE in BINARY mode with this protocolExternal command to RECEIVE in TEXT mode with this protocoldiskprinter file|lpr?Directory names not allowed ?Access denied - %s ?Memory allocation failure printfile nameprintfile is NULL...Use SET SEND or SET RECEIVE instead. Type HELP SET SEND or HELP SET RECEIVE for more info. discard31010Send buffer size?Buffer size required ?Negative numbers can't be used here ?Integer overflow, use a smaller number please ?Too small %dReceive buffer size?Negative numbers can't be used here ?Integer overflow, use a smaller number please ?Too small 3%d400Positive number0?A positive number, please XYCOUN: zbytesize for command characters, 7 or 87 ?The choices are 7 and 8 maximum number of commands in recall buffer10Command screen width, characters80Command screen height, rows24debug.logNumber of seconds before starting to send5full%dEXIT status codexon/xoffset flownoneASCII value?Character must be in ASCII control range noneProgram's command promptMaximum retries per packet10?Retry limit must be greater than window size %d403%dinterval for server NAKs, 0 = none ?Specify a positive number, or 0 for no server NAKs %d404echotype of filetext ?Speed cannot be set for network connections Transmission rate for %s in bits per second?value required ?Sorry, you must SET LINE first ?Unsupported line speed - %ld ?SET SPEED fails, speed is %ld %s, 75/1200 bps %s, %ld bps character-setASCII code for cancellation character3Cancel character must be in ASCII control range How many required to cause cancellation2Number must be 2 or greater onautomaticWildcard expansion is disabled who expands wildcardskermitNumber of sliding-window slots, 1 to 321Window size for current protocol%d406 Adjusting receive packet-length to %d for %d window slots OUTPUT command parameterpacingMilliseconds to pause between each OUTPUT character100control-character prefixing option?Internal error - malloc failure Numeric ASCII value of control character that needs NO prefix, or the word "all", or carriage return to complete the list Numeric ASCII value of control character that MUST BE prefixed, or the word "all", or carriage return to complete the listSET CONTROL atmbufallala XON/XOFF characters 17, 19, 145, 147 not affected. SET FLOW NONE to transmit these characters unprefixed. ?Please specify a number or the word ALL ?Values allowed are: %d-31, 127-159, 255 Sorry, not while Xon/Xoff is in effect. repeat-count compression parameter(not implemented yet, nothing happens) ASCII value?Illegal value for prefix character Seconds from now, or time of day as hh:mm:ss0?Number, expression, or time of day required Sorry, arithmetic overflow - hh:mm:ss not usable on this platform. control-character prefixing optionvalue for login scriptuseridtextSorry, too long discardName of temporary directoryNot implemented - %s hupok xhupok xitwarnhupok networkhupok ttyfd* A network connection to %s might still be active. An incoming network connection might still be active. A serial connection might still be active on %s. OK to close? OK to exit? control quote = %d, applied to (0 = unprefixed, 1 = prefixed): %3d: %d %3d: %d 127: %d %3d: %d %3d: %d 255: %d allcautiousminimalnonepasswordpromptuseridprefixedunprefixedpacing123blank-free-2countsprefixautooffonquietverboseoffonsession0110120015019200200240030036003840048005060072007575/12009600fullhalfbytesizecollisiondestinationdisplaydownload-directoryend-of-lineeolincompletenamestypewarningautomatickeepnonexon/xoffbellcodecresclfnonexoffxonasciibinarytextinternationallocallong-distancenoneaskoffoncapabilitiescarrier-watchcommandcompressiondial-commanderror-correctionescape-characterflow-controlhangup-methodkermit-spoofmaximum-speednamespeed-matchingtypeat-commandscompressiondcecerror-correctionhardware-flowhwfcitukermit-spoofkssbsoftware-flowspeed-bufferingswfctbtelebitv25bis-commandsarea-codecompressionconfirmationconnectconvert-directorycountry-codedial-commanddirectorydisplayescape-charactererror-correctionflow-controlhangupintervalininit-stringintl-prefixintl-suffixkermit-spooflocal-area-codeld-prefixld-suffixmmemethodmnp-enablemodem-hanguppbx-exchangepbx-inside-prefixpbx-outside-prefixprefixrestrictretriessortspeed-matchingstringsuffixtimeouttf-area-codetf-prefixtoll-free-area-codetoll-free-prefixmodem-commandrs232-signalv24-signalautoanswercompressiondial-mode-promptdial-mode-stringerror-correctionhangup-commandhardware-flowinit-stringno-flow-controlpulsesoftware-flowtoneautononerts/ctsxon/xoffdefaultpulsetonekermitshellevenmarknoneoddspaceoffonon-disconnectstatuswarningalwaysoffonlocaloffonremotediscardkeepechoerroroffondeletekeepechoerrorechobytesizeheightmore-promptingquotingrecall-buffer-sizeretrywidthdisplayget-pathlogintimeoutbellcancellationcrc-calculationdisplaylocking-shiftmodeprotocolslow-startautomaticmanualforcedoffoncharacter-setscyrillicdebugdialdynamic-memoryforwardfullscreen-displayhebrewhelpif-commandjob-controlkanjilatin1latin2networkpushrts/ctsredirectscript-commandserver-modeshow-commandtransmitxyzmodemdiskprinterscreengkermitotherxmodemyymodemymodem-gzmodem0123456789ABCDEF@DHLPTX\`dhlptx|W] ,0&_:9;<\ [$#-A6U<VF8O Zci)oty!"SR^ /7GHEDCGFKMLJB%N-O4:?+GMYW#^>g px4~?@ -1 .Q=ZXU5+//3',54;@KT \b)ioy.2   ,0 -* !*(/prescan: no memory for kermrc.kermrc\v(home) prescan arginvalid argument bundlingmissing usernameusername too longdebug.logmissing name in -ydoconect justone 1doconect justone 2doconect justone 3apc_commandsdoconect justone 4doconect justone 5nonenone?Can't open file %s Can't open device %s Can't condition line Can't condition line ^C... transmit char?Can't transmit character transmit bufCan't send buffer Name of debugging log filedebug.logName of packet log filepacket.logName of session log filesession.logName of transaction log filetransact.log ?Unknown log designator - %d ?Sorry, %s is a directory name DispositionnewTransaction Log:Debug Log textbinaryCommunications Parameters: Host: %s Line: %s, speed: unknown75/1200%ld, mode: localremote, modem: %s, TCP/IP, TCP/IP, DECnet LAT, DECnet CTERM, DECnet, Meridian Technologies' SuperLAT, Named Pipes, telnet protocol Terminal bits: %d, p Parity: %s, duplex: half, full, flow: keepautoxon/xoffnonenonerts/ctsnonedtr/ctsnonedtr/cd%d, handshake: %d none offonautounknown Carrier: %s, timeout: %d sec, timeout: none, lockfile: %s Escape character: %d (^%c) No networks are supported in this version of C-Kermit (none) \{%d} Dial status: %d Dial directory: %s (none) Dial directories: %2d. %s Dial method: defaultpulse tone Dial sort: %s onoff Dial hangup: %s Dial display: %s on offonoff Dial retries: %-6d Dial interval: %d Dial timeout: %4d sec0 (auto) Redial number: %s (none) Dial confirmation: %s Dial convert-directory: %s on offonaskoff Dial prefix: %s (none) Dial suffix: %s (none) Dial country-code: %-12s(none)Dial connect: %sonautooff %squietverbose Dial area-code: %-12s(none)Dial restrict: international long-distance local none ? Dial ld-prefix: %s (none) Dial ld-suffix: %s (none) Dial intl-prefix: %s (none) Dial intl-suffix: %s (none) Dial toll-free-area-code: (none)%s Dial toll-free-prefix: %s (none) Dial pbx-exchange: %s (none) Dial pbx-internal-prefix: %s (none) Dial pbx-outside-prefix: %s (none) Transfer mode: %s automaticmanual File type: textbinary?%s literalconverted(unknown) File names: %s Send pathnames: %s offon Receive pathnames: %s offon File collision: %s unknown File destination: %s diskscreenprinter File incomplete: %s keepdiscard File bytesize: %d File end-of-line: %s cr%s lf%s crlf File display: %s none%s serial%s fullscreen%s crt Debug log: %s (none) Packet log: %s (none) Session log: %s (none) Transaction log: %s (none) Initialization file: %s (none) File download-directory: %s (none)\v(tmpdir) Temporary directory: %s Longest filename: %d Longest pathname: %d Protocol: %s Protocol Parameters: Send Receive Timeout (used=%2d):%7d*%8d Timeout (used=%2d):%7d%9d Server Timeout:%4d Padding: %11d%9d Block Check: blank-free-2 Block Check: %6d Pad Character:%11d%9d Delay: %6d Packet Start: %11d%9d Max Retries: %6d Packet End: %11d%9d 8th-Bit Prefix: '%c' Packet Length:%11d %8d Repeat Prefix: '%c' Maximum Length: %9d%9d Window Size:%7d set, %d used Buffer Size: %11d%9d Locking-Shift: forced%senableddisabled,%s%s not used Packet timeouts: dynamic %d:%d Packet timeouts: fixed Auto-upload command (binary): %s (none) Auto-upload command (text): %s (none) Transfer mode: %s automaticmanual Transfer slow-start: %s Attributes: %s Executed by external commands: SEND command (binary): %s (none) SEND command (text): %s (none) RECEIVE command (binary): %s (none) RECEIVE command (text): %s (none) Autoreceive command (binary): %s (none) Autoreceive command (text): %s (none)SHOW what? Most recent transaction -- remote system type : %s files transferred : %ld files not transferred : %ld characters last file : %ld total file characters : %ld communication line in : %ld communication line out : %ld packets sent : %d packets received : %d damaged packets rec'd : %d timeouts : %d retransmissions : %d parity : %s (detected automatically) control characters : %ld prefixed, %ld unprefixed 8th bit prefixing : yes [%c] no locking shifts : %s yesno window slots used : %d of %d packet length : %d (send), %d (receive) compression : yes [%c] (%ld) no block check type used : blank-free-2 block check type used : %d elapsed time : %d sec transmission rate : 75/1200 bps transmission rate : %ld bps effective data rate : %ld cps (%d%%) effective data rate : %ld cps ?Can't condition line for INPUT doinput doinput timodoinput echoinput ttinc(rt) returnsinput interrupted from keyboardinput coninc(rt) returnsdoinput charcompare charinput interrupted from keyboarddoreinput?malloc error 6 doreinp charcompare charfnevalfnevalfneval function argflitfneval malloc failure, argfneval xxstring fails, argfneval argfneval arg post evalfneval evaluated arg fexec pushed too deep ?\fexec() too deeply nested %d%d0%d%d%d%s%ld0%d 0%ld%lu%u%d%d%dunknownUNIX%ld%d%ld%ld%s/%dunknown%ld%dC-Kermit%ld%ldvax%d%d10promptmacrofileunknown%dnoneevenmarkoddspaceunknown%d%ld0textbinaryimagelabeledmacbinaryunknown 2480%dTERM%sunknown%dremoteserialunknown%dTEMPTMP/tmp/%d%d%d%d0%d%d%s%ld?definition is circular or too deep xxstringxxstring r2xxstring r3xxstring function namexxstring function r3xxstring r2 before freexxstring function argxxstring freeing r2xxstring vnameSunMonTueWedThuFriSatJanFebMarAprMayJunJulAugSepOctNovDec_lineapcactiveargcargscmdfilecmdlevelcmdsourcecolsconnectioncountcpscpucrc16d$acd$ccd$ipd$lpdatedaydialnumberdialresultdialstatusdirectorydownloaderrnoerrstringevaluateexitstatusfilespecfsizeftypehomehostinputincharincountinidirinstatusipaddresslinelocalmacrominputmodemm_aa_offm_aa_onm_dc_offm_dc_onm_dialm_ec_offm_ec_onm_fc_hwm_fc_nom_fc_swm_hupm_initm_pulsem_tonendatendaynewlinentimepacketlenparitypasswordplatformprogramquerypromptprotocolreturnrowsspeedstatussysidsystemterminaltfsizetimetmpdirttyfduseridversionwindowxversionbasenamebreakcapitalizecapscharacterchecksumcodecontentscrc16datedefinitionevaluateexecutefileshexifyindexipaddresslengthliterallowerlpadltrimmaximumminimimmodulusnextfilepathnamereprepeatreplacereverserightrindexrpadsizespansubstringtod2secstrimunhexifyupperverifyappendnewP̑S K O<=ncmdini: no memory for keymapcmdini: no memory for macrotabcmdini: no memory for INPUT bufferCan't allocate command buffers!cmdini: no memory for cmdstkcmdini: no memory for ifcmdcmdini: no memory for countcmdini: no memory for iftestcmdini: no memory for intimecmdini: no memory for inpcascmdini: no memory for takerrcmdini: no memory for merrorcmdini: no memory for kermrccmdini: no memory for linecmdini: no memory for tmpbufcmdini: no memory for apcbufCan't allocate macro buffers!ibm-linemodefatalfastcautiousrobust_forx_xif_while_switx\&_[10]\&_[%d]\&@[%d]\&@[%d]/ini file isropen okinit filegetncm dest lengthnext cmdgetncm eom%s getncm returns ptr todomac entry maclvldomac loop maclvl 1domac loop maclvl 2domac loop exit maclvlgetnctgetnct malloc failuregetnct fgets EOFgetnct fgets ok%3d. %sgetnct terminatorgetnct bad lineWarning: Last line of %s lacks terminator command filedirectory filegetnct igetnct lp2getnct comment trimmedgetnct command too long?Line too long, maximum length: %d. getnct first chargetnct last chargetnct bcgetnct continuedgetnct returnparser tmpdir restoring&parser entry maclvl&parser entry inlevel&parser entry tlevel&parser entry cmdlvl&parser entry mtlevelCommand file terminated by error. Command error: macro terminated. DeleteStartupFileparser macroparser maclvlcmdbuf from macro?Error in TAKE command file: %s Memory allocation failureLine too long or contains NUL charactersparser top of while loopCommandtop-level cmkey2top-level cmkey token ?Invalid - %s Command file: %s, line %d docmd returnscmdbufatmbuf?Invalid: %s top-level cmkey failedKermit command error in background execution%sCommand file: %s, line %d parser preparing to continueparser breaks out of while loopxxout obsizexxout pacingxxout stringfreelocal levelVariable name(s)\fcontents(%s)\fdefinition(%s)?Failure to allocate storage for local variables?Failure to allocate storage for local variablesdooutput sdooutputOUTPUT NULOUTPUT BREAKOUTPUT Long BREAKOUTPUT CMDQdooutputOUTPUT error herald%s, for%s Copyright (C) 1985, 1996, Trustees of Columbia University in the City of New York. TEXTBINARYDefault file-transfer mode is %s Type ? or HELP for help. addmmac lineaddmmac linesaddmmac loop exitaddmmac length?addmmac malloc error: %s addmmac malloc erroraddmmac constructed stringaddmmac length mismatch !addmmac internal error! addmac namaddmac def(null pointer)addmac def?addmac malloc error 2 addmac paddmac p(null pointer)addmac numeric global maclvladdmac macro arg maclvladdmac globaladdmac macro error 7: %s addmac macro defaddmac table sizeaddmac table overflowaddmac position?addmac malloc error 3: %s ?addmac malloc error 5: %s delmac namdelmac defdelmac def(null pointer)delman defdelmac def(null pointer)delmac mlookpopclvl cmdlvlpopclvl tlevelpopclvl maclvlpopclvl mac 1popclvl mac 2popclvl mac 3popclvl mac 4popclvl mac 6popclvl mac 7popclvl mac 8?Debugging log wasn't open Debug Log Closed?Packet log wasn't open ?Session log wasn't open ?Transaction log wasn't open Transaction Log Closed ?Unexpected log designator - %d onoff Versions: %s Numeric: %ld-%d C-Kermit %s %s for%s %s %s for%s %s %s %s %s %s %s %s %s Major optional features included: External XYZMODEM protocol support RESEND command Control-character unprefixing Major optional features not included: No fullscreen file transfer display No network support No hardware flow control No character-set translation No UNIX job control No REDIRECT command None Compiler options: DEBUGTLOGXFRCANCK_SPEEDCK_APCCK_AUTODLCK_MKDIRWHATAMIDYNAMICCMDDEP=%dCKMAXPATH=%dMAXGETPATH=%dCMDBL=%dVNAML=%dARRAYREFLEN=%dFORDEPTH=%dMAXTAKE=%dMACLEVEL=%dMAC_MAX=%dMSENDMAX=%dMAXDDIR=%dMAXDNUMS=%dUNIXNDIRCK_TMPDIRCK_TTYFDSELECTNOSYSIOCTLHNOSETBUFNOKVERBSNOSETREUBSD4vaxCK_TTGWSIZDCMDBUFCK_RECALLCK_TIMERS \{%d} Key code \%d => String: \{27}[\{%d} String: \{27}[%c String: \{27}\{%d} String: \{27}%c String: Character: \%u%c \%u (self, no translation) Terminal parameters: %19s: %1d%-12s %13s: %1d%-14s Bytesize: Command bitsTerminal bitsTERM %19s: %-13s Type(unknown) %19s: %-13s %13s: %-15s EcholocalremoteLocking-shift %19s: %-13s %13s: %-15s Newline-modeCr-displaycrlfnormalonoffunchecked %19s: %-13s %13s: %-15s APCAutodownloadonoff %19s: %-13d %13s: %-15d HeightWidth %19s: %-13s %13s: %-15s DebugSession log(none) CONNECT-mode escape character: %d (Ctrl-%c, %s): %s DEL Press key: ?Error reading key Macro name, or carriage return to see them all%s - not found Macros: %d Function Status: GET %s RETRIEVE %s SEND %s MAIL %s PRINT %s REMOTE ASSIGN %s REMOTE CD/CWD %s REMOTE DELETE %s REMOTE DIRECTORY %s REMOTE HOST %s REMOTE QUERY %s REMOTE RENAME %s REMOTE SET %s REMOTE SPACE %s REMOTE TYPE %s REMOTE WHO %s BYE %s FINISH %s Server timeout: %d Server display: %s Server login: (none) "%s", "%s", "%s" Server get-path: (none) %d. %s %s SUCCESSFAILURE The following functions are available: \F() \v(%s) = \{%d} \{%d} %s %s Global variables: \%%%c No variables defined Macro arguments at level %d \%%%d = %s No macro arguments at top level Declared arrays: \&%c[%d] No arrays declared Cancellation: %s %d %d Send / Receive Pause: %d (msec) Type SHOW DIAL to see DIAL-related items Command Quoting: %s Take Echo: %s Take Error: %s Macro Echo: %s Macro Error: %s Input Case: %s ObserveIgnore Input Buffer-length: %d Input Echo: %s Input Silence: %d (seconds) Input Timeout: %s quitproceed Last INPUT: -1 (INPUT command not yet given) Last INPUT: %d (%s) Output Pacing: %d (milliseconds) Script Echo: %s Command buffer: %d Atom buffer: %d File type: %s binarytext See SHOW CHARACTER-SETS for character-set info Terminal echo: %s localremote Transmit EOF: none ^%c%c Transmit Fill: %d (fill character for blank lines) Transmit Fill: none Transmit Linefeed: %s on (send linefeeds too)off Transmit Prompt: %d (host line end character) Transmit Prompt: none Transmit Echo: %s Transmit Locking-Shift: %s Transmit Pause: %d milliseconds Escape character: Ctrl-%c (ASCII %d, %s): %s DEL, speed: unknown75/1200%ldoffonautounknown, carrier: %s, timeout: %d sec, timeout: none Type SHOW MODEM to see modem settings. Type SHOW COMMUNICATIONS to see modem signals. Character set translation is not supported in this version of C-Kermit Exit warning %s onalwaysoff Exit on-disconnect: %s Current exit status: %d Printer: %s%s | (default) Command bytesize: %d bits Command recall-buffer-size: %d Command retry: %s onoff Command quoting: %s Command more-prompting: %s Command height: %d Command width: %d Maximum command length: %d Maximum number of macros: %d Macros defined: %d Maximum macro depth: %d Maximum TAKE depth: %d Alarm at %s %s (no alarm set) send-list is empty (none)%s, mode: %s, alias: %s Nothing to show... Line: %s, Modem type: Communication device not yet selected with SET LINE Modem type: %s %s = (null definition)Attributes: %s Blocksize: %s Date: %s Disposition: %s Encoding (Character Set): %s Length: %s Type (text/binary): %s System ID: %s System Info: %s invalid digit '%c' in number Invalid character '%c' in input +-|<>#@extra characters after expression %ldmissing right parenthesis operator unexpected ?Array reference too long - %s ?Not an array - %s ?Invalid format for array name - %s ?No closing bracket on array dimension - %s ?Array dimension or subscript must be numeric - %s ?Array dimension or subscript must be positive or zero - %s ?Not a variable name - %s ?Incomplete variable name - %s ?Only one character after '%%' in variable name, please ?Array subscript expected - %s ?Invalid array reference - %s ?Array not declared or subscript out of range \m(%s)%dxwords macrododo maclvldodo maclvl too deepMacros nested too deeply do macrododo cmdlvl too deep?TAKE files and DO commands nested too deeply do macro%0litcmdlitcmd2litcmd3litcmd4litcmd5litcmd6litcmd7litcmd8litcmd9Name of local directory, or carriage return?Wildcards not allowed in directory name %s %s %s[\v(dir)] C-Kermit>set parity mark, set dupl half, set handsh xon, set flow noneif def \%1 echo \%1, if not = \v(local) 0 hangup, stop 1set win 4, set rec pack 2200, set prefix minimalset win 4, set rec pack 1000, set prefixing cautiousset win 1, set rec pack 90, set prefixing all_assign _for\v(cmdlevel) { _getargs,define \\\%1 \feval(\%2),:_..top,if \%5 \\\%1 \%3 goto _..bot,\%6,:_..inc,incr \\\%1 \%4,goto _..top,:_..bot,_putargs},def break goto _..bot, def continue goto _..inc,do _for\v(cmdlevel) \%1 \%2 \%3 \%4 { \%5 },_assign _for\v(cmdlevel)_assign _whi\v(cmdlevel) {_getargs,:_..inc,\%1,\%2,goto _..inc,:_..bot,_putargs},_def break goto _..bot, _def continue goto _..inc,do _whi\v(cmdlevel),_assign _whi\v(cmdlevel)_assign _sw_\v(cmdlevel) {_getargs,_forward \%1,\%2,:_..bot,_putargs},_def break goto _..bot,do _sw_\v(cmdlevel),_assign _sw_\v(cmdlevel)_assign _if\v(cmdlevel) {_getargs,\%1,_putargs},do _if\v(cmdlevel),_assign _if\v(cmdlevel)successtimeoutinterruptedinternal errori/o errordisabledlocal onlyremote onlyenabled\flit(()+)/)3)6)<)C)J)O)U) W)Y) [)a)l)r)z))))))))) ) )))))))) Variable name?Variable name required ?Read file not open ?Oops, no READ buffer! read zsinlread addmacPrompt, enclose in { braces } to preserve leading and trailing spaces, precede question mark with backslash (\).{ Yes or no? }Please respond Yes or No getc addmacPlease respond.ASK cmtxt ask addmacVariable name?Variable name required by amount1?Variable %s not defined or not numeric Macro or variable nameMacro or variable name?Variable name required dodef successdodefDefinition of variablexxdef var namexxdef var def?Argument vector array is read-only Definition of array elementxxdef array refxxdef array defDefinition of macroxxdef macro namexxdef macro defcalling addmac?%s failed ASSIGNDEFINE1996101719961011dncvtError - No phone number to convert %s%s%s%sError - prior SET DIAL COUNTRY-CODE command required Error - phone number ends prematurely: "%s" Error - No international dialing prefix defined %s%s%s%s%s%s%s%sWARNING - Prior SET DIAL AREA-CODE needed %s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%s%sError - No international dialing prefix defined %s%s%s%s%s%srw Saving old directory as %s. Converting %s...; %s - Kermit dialing directory %-16s %-20s ; %5s %-6s ; %s ; NameNumberSpeedParityComment %-16s %-20s ; %5s %-6s %s OK rOpening: %s... noneevenspacemarkodd ERROR: You seem to have old- and new-format entries mixed in your dialing directory. You'll have to edit it by hand to convert it to the new format. Type HELP DIAL for further information. WARNING: Old-style dialing directory detected: %s Shall I convert it for you? Sorry, can't convert. Will ignore speed and parity fields, continuing... OK, will ignore speed and parity fields, continuing... ?internal error - ludial malloc 1 Warning: %d matches found, %d max ?internal error - ludial malloc 2 Lookup: "%s" - ambiguous%s - dialing skippedPlease SET HOST first, and then SET MODEM Sorry, you must SET MODEM first Sorry, you must SET LINE or SET HOST first /dev/nullSorry, you must SET SPEED first timeout (seconds)0Number to dial or entry from dial directoryNumber to dial?Lookup what? %s ?No DIAL command given yet?You must specify a number to dialdodial Lookup: "%s" - not found%s - dialing as given dodial Lookup: fatal error - dialing skipped Lookup: skipped Lookup: "%s" - exact match Lookup: "%s" - uniquely matches "%s" %d telephone number%sfound for "%s"%s s :.%3d. %-12s %-20s => %-20s (%d) (processing failed)And %d more... Dial attempt %d of %d... Restricted: %s, skipping... Dialing %s Is this number correct? Please enter the correct number, or press Return to skip: Corrected phone number Will redial in %d second%s- press any key to redial immediately. s Ctrl-C to cancel... Directory/file specificationDIR fs_copyCK_DIR%s %sDIRFile(s) to delete?A file specification is required xxdel tmpbuf%s %sxxdel line%s - %sdeleted not ?ELSE doesn't follow IF command to be ignoredVariable name?Variable name required _switx SWITCH SWITCH 2series of cases?Unbalanced brackets SWITCH 3_switx_switx_switx?SWITCH macro definition gone! SWITCH commandVariable name?Variable name required _forx initial valuedofor fx%dfinal valuedofor fy%dincrement1dofor fz%dCommand to execute?Unbalanced brackets _forx_forx_forx?FOR macro definition gone! FOR command?Incomplete FOR command Before requesting technical support from Columbia U., please consult: . The book "Using C-Kermit". . The CKCKER.UPD and CKCKER.BWR files. . The CKUKER.BWR and CKUINS.DOC files. . Your own organization's support staff, if any. . The comp.protocols.kermit.* newsgroups if you have Netnews access. . Our FAQ, http://www.columbia.edu/kermit/faq.html, if you have Web access. If you still need help or have a bug to report after consulting these sources, send e-mail to: kermit-support@columbia.edu Or contact us by post: Kermit, Columbia University, 612 W 115 Street, New York NY 10025, USA Or by fax at +1 (212) 663-8202. Telephone support is available too: +1 (900) 555-5595, USA only, $2.50 per minute +1 (212) 854-5126, from anywhere, $25.00 per call, MC/Visa Before reporting problems, please use the SHOW VERSION and SHOW FEATURES commands to get detailed program version and configuration information. tod2sectod2sec t2seconds to wait, or time of day hh:mm:ss1seconds to pause, or time of day hh:mm:ss1milliseconds to sleep, or time of day hh:mm:ss100?Number, expression, or time of day required modem signalSorry, arithmetic overflow - hh:mm:ss not usable on this platform. File to rename?Name of existing file required ?Please specify a single file New name?New name for file required dorename linedorename p?Can't rename %s to %s ?Can't return from level %d RETURN parseRETURN maclvl 1_xif_for_whiRETURN poppingRETURN maclvl 2RETURN maclvl 3RETURN copymode?Mode required ?Read file already open File to read?Input filename required ?Please specify a single file buffer size4096?Positive number required ?Can't allocate read buffer ?Read from pipe disabled ?Read file already open System command to read from?Command name required ?Can't allocate read buffer ?Write to pipe disabled ?Write file already open System command to write to?Command name required Can't open process for writing: %s Name of local file to create?Filename required ?Sorry, %s is a directory name ?Write/Append file already open ?Not implementedCommand file ends prematurely in multiline GET OofaRemote filename missing in multiline GET MupeenMacro definition ends prematurely in multiline GET OofaRemote filename missing in multiline GET Mupeen Remote file specification: Name of remote file(s) cmtxt(cancelled) Local name to store it under: Local file name(cancelled) xxget cmargxxget fspecRECEIVE arg disk or dir?Can't get current directory ?Can't access %s _getargs maclvl_putargs maclvlsuccess_getarg p(null pointer)_getarg p_putarg m_arg[maclvl+2][i]_putarg m_arg[maclvl+2][i](null pointer)_get/putarg exit_get/putarg exit maclvl_get/putarg exit argc maclvlgoto cxgoto cmdlvlgoto maclvlgoto tlevelgoto before conversiongoto after conversion?Bad label syntax - '%s' ?Sorry, GOTO only works in a command file or macro goto in macromacro GOTO labelmacro target label:defaultgoto failed at cmdlvl?Label '%s' not found goto found macro label:defaultgoto failed at cmdlvl?Label '%s' not found ?Stack problem in GOTO %s ]()chkvar?Condition required ?No keywords match - "%s" if trueif trueif successif failureMacro or variable nameif definedif countFileDirectory name?File or directory name required if exist 1if directory 1if directory 2first word or variable name?Text required ?IF: strings too long second word or variable name?Text required ?IF: strings too long IF EQ string 1, xIF EQ string 2, yIF EQ strcmpIF EQ xxstrcmpfirst number or variable name?Quantity required xxifgt cmfldxxifgt exp1countversionargcsecond number or variable name?Quantity required xxifgt exp2countversionargcxxifft ifcxxifft n1xxifft n2xxifft zvariable name or constant?Quantity required xxifnu cmfldxxifnu quantityxxifnu chknumFirst fileSecond file?Failure to get file date xxifnewer d1xxifnewer d2xxifnewer\v(ndate)IF ALARM date\v(ntime)IF ALARM timeIF ALARMIF conditiondoif: pushing command command to be ignoredObject commandelse_xif_xif_xif?XIF macro gone! { \flit(if not goto _..bot) } WHILE cmdObject commandWHILE body_while_while_while?WHILE macro definition gone! WHILE dodo?Can't allocate storage for WHILE commandrFailure to open?TAKE files and/or DO commands nested too deeply cdctsdsrri!read!writeappendreadwrite<=>alarmbackgroundcountdefineddirectoryemulationequalerrorexistfailurefalseforegroundlltlgtnewernotoknumericremote-onlystarted-from-dialersuccesstrueAAAAAAAGAKASAGAAAAAAAAB BBB B-B7B>BEB OBUBcBhB kBpB sB}BBBBB BBB BBBBBB BBCCCCC!C%C*C.C1C7C>CLCTCcCqCCCCGCCCC C"CCC C CC#C%D$ DDD $D -D4D8D;DED JDXD]DmDrDzDDDDDDDonsetnum ?Value required %s?Not a number: %s ?Sorry, %d is the maximum Control character, numeric ASCII value, or in ^X notation, or preceded by a backslash and entered literally ?Not a control character - %d ?Not a control character - %s ?Invalid - %s ?Not in ASCII control range - %d file transfer display styleRemote file parameter?Remote file parameter required File parameterfile byte size (7 or 8)8 ?The choices are 7 and 8 crlflocal text-file line terminatorhow to handle filenamesconverted%d301%dfile record length%d312type of file transfertext%d300Filename collision actionbackup%d302Name of local directory, or carriage returndownload dir?Wildcards not allowed in directory name download zfnqfp?unexpected file parameter bytesize for terminal connection8 ?The choices are 7 and 8 Sorry, this version of C-Kermit does not support the SET TERMINAL TYPE command. Type "help set terminal" for further information. which side echos during CONNECTremoteenablednormalapplication program command executionnumber of columns on your screen80number of rows on your screen24Parameter for inbound packetsParameter for outbound packets?Remote receive parameter required ASCII value of control prefix?Illegal value for prefix character 13Sorry, the legal values are 0-31 Maximum number of characters in a packet90Sorry, 10 is the minimum %d401 Adjusting receive packet-length to %d for %d window slots Sorry, bad packet length for XMODEM. Please use 128 or 1024. Sorry, 10 is the minimum Adjusting packet size to %d for %d window slots Sorry, bad packet length for XMODEM. Please use 128 or 1024. Remember to SET BLOCK 2 or 3 for long packets. Code for packet-start character1How many padding characters for inbound packets00%dPacket timeout interval%d402Packet timeout interval?Out of range - %d dynamicMinimum timeout to allow1?Out of range - %d Maximum timeout to allow0onMilliseconds to pause between packets0Characters to send at end of file, Use backslash codes for control characters?Too many characters, %d maximum Numeric code for blank-line fill character0Numeric code for host's prompt character, 0 for none10Number of milliseconds to pause between binary characters or text lines during transmission0 Press the X or E key to cancel. > filename, | command, or type carriage return to confirm the command?Not confirmed ?%s missing FilenameCommand?Access denied - %s remcfm remfileremcfm remappdremcfm rempiperemcfm remdest?%s missing FilenameCommand?Access denied - %s remtxt remfileremtxt remappdremtxt rempiperemtxt remdestremtxt command?Parameter name required Remote directory nameXZCWD: passwordName of remote file(s) to delete?Name of remote file(s) required Remote directory or file specification?Not available - %s Command for remote systemCommand for remote Kermit?Remote Kermit command required User IDInternal error: malloc PasswordInternal error: malloc Account or carriage returnInternal error: malloc ?Disposition Attribute is Off Local file(s) to print on remote printer?Name of local file(s) required Options for remote print command?Option string too long Confirm, or remote directory nameRemote file specification?Remote filename required Remote user name, or carriage returnRemote variable nameQRemote variable nameAssignment for remote variableSName of remote file to copy?Name of remote file required Name of remote destination file or directory?Name of remote file or directory required Name of remote file to rename?Name of remote file required New name of remote file?Name of remote file required ?Not implemented - %s ?File specification required rfilopFile Attribute packetsSorry, command not available 132101421014110135101331013910134101451014710?Not available Positive numberSeconds of inactivity before INPUT fails%dNumber of bytes in INPUT buffer?Network connections not supported Communication device name?Timed out, no carrier. Try SET CARRIER OFF and SET LINE again, or else SET MODEM, SET LINE, and then DIAL. Sorry, access to lock denied: %s Sorry, access to device denied: %s Sorry, device is in use: %s Sorry, can't open connection: %s set line ; C-Kermit SAVE KEYMAP file: ; Clear previous keyboard mappings set key clearset key \%d \{%d}%cset key \%d \{%d}; EndName of INI filekeymap.ini?Sorry, %s is a directory name DispositionnewNot implemented - %s asciibinarytextasciibinarytextglobalkermitsystemuserdynamicfixedechoeoffilllinefeedlocking-shiftpausepromptappendbackupdiscardno-supersedeoverwriterenameupdatecollisionnamesrecord-lengthtypecrcrlflfconvertedliteralapcautodownloadbytesizecr-displaydebugechoescape-characterheightlocking-shiftnewline-modetypewidthcrlfnormaloffonuncheckedfixedundefinedcrtnoneoffonquietserialpacket-lengthtimeoutcontrol-prefixend-of-packetpacket-lengthpad-characterpaddingpathnamespausequotestart-of-packettimeoutattributesblock-checkfileincompletereceiveretryservertransferwindowalldatedispositionencodinglengthoffonsystem-idtypebuffer-lengthcasedefault-timeoutechosilencetimeout-actionproceedquitignoreobservedisabledenabledO OOOOO O$O(O+O.O1O4O7O:O=O@ODOLOPOYO]OaOeOiOmOpOtOxO{O~OOevenoddmarkspacenoneinvalidModem signals unavailable in this version of Kermit No modem control for this device Modem signals unavailable Carrier Detect (CD): %s OnOff Dataset Ready (DSR): %s OnOff Clear To Send (CTS): %s OnOff Ring Indicator (RI): %s OnOff Data Terminal Ready (DTR): %s OnOff Request To Send (RTS): %s OnOffspar: data spsiz timint npad padch seol ctlq ebq ebqflg bctr rptq rptflg lscapu atcapu lpcapu swcapu wslotn whatrurpar: data rpsiz rtimo mypadn mypadc eol ctlq sq ebq ebqflg bctr rptq rptflg capas bits lscapu atcapu lpcapu swcapu wslotr rpsiz(extended)fatalFatal:setgen: can't allocate memorysetgenfnparse malloc errorfnparsefnparse rCK_NOPUSHHOSTmore? Y or space-bar for yes, N for no ^C trap() caught signal^C trap() curses^C...^C... ?T-Log string too long%s %ld %s %ld?String too long[%s]?String too long[%s] %ld?String too long%s: %ld?String too long%s %s?String too long%s %s: %ld?Invalid format for tlog() - %ldconchkconincStatus report: file type: labeledimagebinary undefinedbinarytext file number size characters so far percent done block check: blank-free-2 block check compression 8th-bit prefixing locking shifts speed packet length packet length window slotsCanceling batch, wait... Canceling batch... Canceling file, wait... Canceling file... Resending packet... X to cancel file, CR to resend current packetZ to cancel group, A for status reportE to send Error packet, Ctrl-C to quit immediately: Ctrl-C to cancel file transfer: Sending: Receiving: => Size: %ld, Type: Size: unknown, Type: labeledimagebinary undefinedbinarytext File Percent Packet Bytes Done CPS Length%c%9ld%5ld%%%8ld%8ld %c%9ld %8ld%8ld [OK] [discarded] [interrupted] [skipped]Error: Message: Refused: [incomplete]*** screen() called with bad status ***%s: %ld*** screen() called with bad object ***ermsgProtocol Error:Transaction Log Closedon_exitdoexit exitstatdoexit whatC-Kermit EXIT status(NULL)(NULL)(string too long)(string too long)%s%s:%c %s%s:^%c %s%s:~^%c %s%s:~%c %s%s:%ld =%ld [%s] [%s]=%ld %s=%ld %s[%s] %s[%s]=%ld ?Invalid format for debug() - %d NULSOHSTXETXEOTENQACKBELBSHTLFVTFFCRSOSIDLEDC1/XONDC2DC3/XOFFDC4NAKSYNETBCANEMSUBESCFSGSRSUS%s "%s" - %s%s cmdlincmdlin cfilefxargvinvalid command-line option, type "kermit -h" for helpaction-l or -j or -X required-l or -j or -X required-a without -s, -r, or -g-a without -s, -r, or -gcan't change to '-a' directorycan't change to '-a' directorywrite access to -a file deniedwrite access to -a file deniedunredirected -k can only be used in local modeunredirected -k can only be used in local modedoarg entrydoarg argNo commands given for -CNo commands given for -Cinvalid argument bundlinginvalid argument bundlingmissing delay valuemissing delay valuebad delay valuebad delay valueconflicting actionsconflicting actionsconflicting actionsconflicting actionsconflicting actionsconflicting actionsconflicting actionsconflicting actionsconflicting actionsconflicting actionsinvalid argument bundling after -sinvalid argument bundling after -s-No files for -sNo files for -s-s: too many -'s-s: too many -'sinvalid mixture of filenames and '-' in -sinvalid mixture of filenames and '-' in -sdoarg s nfilsdoarg s zsending from terminal not allowedsending from terminal not alloweddoarg s stdinfconflicting actionsconflicting actionsinvalid argument bundling after -ginvalid argument bundling after -gmissing filename for -gmissing filename for -ginvalid argument bundling after -ainvalid argument bundling after -amissing name in -amissing name in -ainvalid argument bundling after -yinvalid argument bundling after -ymissing filename in -ymissing filename in -yinvalid argument bundling after -l or -jinvalid argument bundling after -l or -jcommunication line device name missingcommunication line device name missing/dev/ttycan't open devicecan't open devicecmdlin speedinvalid argument bundlinginvalid argument bundlingmissing bpsmissing bpsunsupported transmission rateunsupported transmission rateinvalid argument bundling after -minvalid argument bundling after -mmodem type missingmodem type missingunknown modem typeunknown modem typeinvalid argument bundling after -einvalid argument bundling after -emissing lengthmissing lengthUnsupported packet lengthUnsupported packet lengthinvalid argument bundlinginvalid argument bundlingmissing or bad window sizemissing or bad window sizeUnsupported packet lengthUnsupported packet lengthinvalid argument bundlinginvalid argument bundlingmissing paritymissing parityinvalid parityinvalid parityinvalid argument bundlinginvalid argument bundlingmissing usernamemissing usernameinvalid command-line option, type "kermit -h" for helpl}}  }}*}.}}?}|}q}_}s}7}5}6}7}k}t}Q}}}&}}\}}}*~ ~~~G~G"~;,~3~:~(?~I~ Q~2T~ V~O_~ d~m~<r~@y~0}~h~ ~ ~ ~ ~H~H~i~~ ~ ~ ~g~V~/~~+~~~-~~9~~[~~~~} ovd& +v1m7l<]CPHPKPQ]X[^`{giDnu{r0f3wESn8&eCCw  )$( -3!6!:!@F"Q1V]$b4gsl%u&zz?>I'AAAAaaŀJɀ%΀NЀXՀX݀YTU!#;:@ K"#3%3(338D2L.Z7_6c6ko6w'4T0сEցہ      * @N$+*0D7>CFFNMX_Lh?n v}A#1O(Pς!؂%/;$ %/C"%*.5?DIPV] cgm tx~ăʃσڃ  )7 CP@Z[gq|'Ƅ̈́؄"" #%-29 >GLV^`dkq|! (   ɅӅ܅ (   !(,16<BIRW [ a f jsdocmd entry, cx docmd XXGTAdocmd cxdocmd XXGTA maclvldocmd dogta returnsdocmd dogta maclvlSorry, BYE only works with Kermit protocol item to cleardevice-and-inputText of comment lineCarriage return to confirm, or optionWhich log or file to close?You must say which file or log Integer arithmetic expression%s Array name?Array name required ?Declare failed dodial returnsServer function to enableServer function to disable?Name of server function required modeboth?Please specify remote, local, or both optional return valueoptional return value ?No macros defined macro?Macro name required optional argumentsText to be echoedApplication Program Command text%s %s%c_%s%c\%c_%s%c\Text to be outputOUTPUT 1OUTPUT 2OUTPUT 3OUTPUT sizeOUTPUT 4File to print?A file specification is required ?Wildcards not allowed Local print command options, or carriage returnexit status codeSorry, E-PACKET only works with Kermit protocol Sorry, FINISH only works with Kermit protocol Sorry, "%s" only works with Kermit protocol Name of remote file(s), or carriage returnC-Kermit commandhelpHELP command xtop-level cmkey token ?Invalid - %s label?Label name required %dseconds to wait for input, or time of day hh:mm:ss?Number, expression, or time of day required Sorry, arithmetic overflow - hh:mm:ss not usable on this platform. List of input stringsMINPUT cmfld returns?Memory allocation failure MINPUTMaterial to be input?Memory allocation failure xxrei line?INPUT timed out ?MINPUT timed out ?REINPUT failed label?Label name required What to log?Type of log required expect-send expect-send ...Name for incoming file Name under which to store the (first) incoming file, or: name of directory in which to store all the file(s), or: confirm the command now to store the files in the current directory under their own names.Sorry, you must specify a name when receiving a file with XMODEM protocol DOWNLOAD arg disk or dir?Can't get current directory ?Can't access %s cmofi cmarg2Sorry, REMOTE commands only work with Kermit protocol Remote Kermit server command?You must specify a command for the remote server Name of listsend-list?Sorry, ADD SEND-LIST does not work with external protocols ?Sorry, FILE TYPE must be BINARY or IMAGE Sorry, RESEND is only possible with Kermit or ZMODEM protocol ?Sorry, ATTRIBUTE DISPOSITION must be ON File to sendFile(s) to send?No send list - use ADD to make one. Sorry, you can only send one file at a time with XMODEM protocol WARNING - \v(filespec) buffer overflow ?Sorry, wildcards not permitted in this command ?Sorry, this command needs 32-bit integers ?Sorry, PSEND works only with Kermit protocol starting position (byte number)type of file transferSend: wildName to send it withSending: as:Sorry, MAIL can be sent using Kermit protocol ?Disposition Attribute is Off Mail: wildAddress to mail to?Address required ?Option string too long Mailing:To:Sorry, can't allocate space for as-nameSorry, can't allocate space for nameSorry, can't allocate file list nodeSorry, you can only send one file at a time with XMODEM protocol Names of files to send, separated by spaces?A file specification is required ?MSEND list too long msfiles WARNING - \v(filespec) buffer overflow Sorry, SERVER only works with Kermit protocol optionkeymap?You must specify an option to save ?More fields required Parameter?You must specify a parameter to set ?More fields required System command to executeRUN zshcmd codeparametersConfirm for current disk, or specify a disk device or directory%s %sexit status code0Message to print%s END maclvl 1_xif_for_whiEND poppingEND maclvl 2END maclvl 3Sorry, this version of Kermit cannot be suspended ?Take files nested too deeply \v(home)C-Kermit command file?A file name is required ?Wildcards not allowed in command file name File to transmit?Name of an existing file ?Only a single file may be transmitted calling transmitFile to type?Name of an existing file ?A single file please TYPECommand Level: %d Level %d %s [%s] %s, for%s Numeric: %ldC-Kermit %s -%d user nameCK_WHO%s %sto file or log?Write to what? text%s%s ?Write error ?File or log not open Name for new directoryName of empty directory to removekermit command-line arguments, -h for helpkermit %s docmd unk argUser Interface 6.0.177, 6 Sep 96send-list!#:@aboutaddanswerapcasciiasgaskaskqassignbeepbinarybugbyeccatcdcheckclearclosecommentconnectcwddatedcldeclaredecrementdefinedeletedialdirectorydisabledoee-packetechoeightbitelseenableendevaluateexexitffinishfoforforwardfotggegetgetcgetokgotohhanguphelpiifinincrementinputintroductionkermitllocalloglookuplsmailmanmdminputmgetmkdirmmovemovempausemputmsmsendmsleepmvnewsnopushoopenoutputpausepdialpopprintpsendpupushputpwdquitrrdreadreceiveredialregetreinputremoterenamereplayresendretretrievereturnrmrmdirrunssavescriptsendserversetshowsleepspspaspacespawnstatisticsstopswitchtaketesttexttransmittypeundefineversionwaitwhilewhowrwriwritwritewrite-linewritelnxechoxifxmitz_asg_assign_define_forward_getargs_putargsnookyeskeymapalarmattributesbbabackgroundbaudblock-checkbufferscarrier-watchcasecmdcommandconconsolecontrol-charactercountddedebugdefaultdelaydestinationdialduplexescape-characterexitfileflow-controlhandshakeiinincompleteinputkeyllinelocal-echologinmacromodemoutputparityportprprinterprefixingpromptprotocolquietreceiverepeatretry-limitscriptsendserversession-logspeedstartup-filetaketemp-directoryterminaltransfertransmitwildcard-expansionwindow-sizexferxmitasasgassigncdcopycwddeletedirectoryhelphostkermitloginlogoutprintpwdqueryrenamesetspacetypewhodebuggingpacketssessiontransactionsappend-filedebug-logerrorfilepacket-logscreensession-logsys$outputtransaction-logapcbothdevicedevice-and-inputdevice-bufferdial-statusinput-buffersend-listappend-filedebug-logpacket-logread-filesession-logtransaction-logwrite-filealarmargargumentsargsarraysattributescharacter-setscmdcomcommcommunicationscommandcontrol-prefixingcountddefaultdialescapeexitfeaturesfilefunctionsglobalskkeymacrosmodemparametersprinterprefixingprotocolscriptssend-listserverstatusterminaltransmitvariablesversionsxmitbothremotelocalallasasgassignbyecdcwddeletedirectoryfinishgethostmailqueryprintrenameretrievesendsetspacetypewho/quietlydial,ȏߏ,UuՐ@fAPC beginAPC terminatedforkint - CK_FORK_SIGck_sndmsg - notifying parentck_sndmsg - returningpipeint argpipeint code (Back at %s) local UNIX system pipeint duplexautoupload at parentautodownload at parentAPC at parentCKCPUTC obcCKCGETC 1 ibcCKCGETC 1 calling ttinc(0)CKCGETC 1 ttinc(0)CKCGETC 2 ibckbget errnoCONCLD entry?setuid error - fatal CONNECT starting port forkCONNECT port fork ibcCONNECT port fork obcCONNECT disconnect ibcCONNECT disconnect obc Communications disconnect Can't read character** PORTset proto %s, %s, set proto %sserverreceiveautodownload%c%s%c# N3autodownload complete ibcautodownload complete obcautodownload justoneAPC completeAPC complete ibcAPC complete obcCONNECT fork signalSorry, you must SET LINE first Sorry, you must SET SPEED first Sorry, CONNECT input buffer can't be allocated Sorry, CONNECT output buffer can't be allocated Sorry, CONNECT keyboard buffer can't be allocated Sorry, CONNECT temporary buffer can't be allocated ckucon entry ttyfdckucon entry ibcckucon entry obcckucon entry kbcckucon entry ttchkckucon openingSorry, can't open %sckucon open failureConnecting to %s, speed %ld. The escape character is Ctrl-%c (ASCII %d, %s) DELType the escape character followed by C to get back, or followed by ? to see other options. . ESCAPE CHARACTER IS DISABLED (Session logged to %s, %s) binarytextDebugging Display...) Sorry, can't condition console terminal CONNECT cmaskCONNECT cmdmskCONNECT speed before ttvtCONNECT ttvtSorry, can't reopen %sSorry, Can't condition communication line CONNECT ttvt ok, escapeescseqCONNECT parent pidCan't make pipeCONNECT pipe errorCan't make port forkCONNECT fork error Communications disconnect (Back at %s) local UNIX system CONNECT fork pidCONNECT keyboard fork duplexCONNECT setjmp normal entrykmptr non NULLmacro empty, continuingchar from macro** KEYBCONNECT keyboard read errnoCONNECT got escape Can't send characterCONNECT signaling port forkCONNECT killing port forkCONNECT killed port fork(Back at %s)local UNIX system ckucon exit ibcckucon exit obc ? for this message 0 (zero) to send a null B to send a BREAK L to send a Long BREAK U to hangup and close the connection Q to hangup and quit Kermit S for status ! to push to local shell Z to suspend (disabled) \ backslash code: \nnn decimal character code \Onnn octal character code \Xhh hexadecimal character code terminate with carriage return. Type the escape character again to send the escape character, or press the space-bar to resume the CONNECT command. Press C to return to the C-Kermit prompt, or:Command>doesc Hanging up Connected %s %stothrough, speed %ldTerminal bytesize: %d, Command bytesize: %d, Parity: noneevenoddspacemarkTerminal echo: %slocalremoteLogging to: Error resuming CONNECT session ERROR WRITING SESSION LOG, LOG CLOSED!CONNECT Command for UNIX, 6.0.083, 6 Sep 96p )( "#$%&'()*+,-.TY#^`fjklL+s{|}~` ,}<=>?@ABCGHIJKLMNOPQRSno(p sx|}~L+,}#L+,} %#*,DHIJL+QY`gn},}#L+&/7?@},}A#L+  },}6;#@B]abcL+jry},}#L+ "&-4<DK},}Rkp#uwL+},}"#')9=>?L+FNU\cjqx},}#L+ &-4;IW_gn},}u#L+},}).#35[_`aL+hpw~},}#L+!)3@GT[biqyz},}{#L+(08@HP},}Xqv#{}L+},}(-#24IMNOL+V^eov}},}<K %#*,=ABCL+JR_ly},}<d PL+&9GU^m|K,}<dPL+,6@JT\de,}fnopqrstxyz{|}~#L+&.67},}8W\#acL+  },}*/#46Y]^_L+fnu},}#$()*L+19@AHOV`jrz{=,}|#L+ #*2:;=,}<TY#^`L+  },} %&'.678ABCDEFGHIJKLM]^_adefijklmnopqrstu  2, !"#$%&'()*>?#@C2FHKMLQTUVWXYZ[\]^fghj,nps#` #d &,2?KRY\]^,}_v{#L+=,}̕DdܣT̤Dܔ4T$,4$\ԜLĝl|< td(1:BGT0]fnv.        &3?KQ^(fimrx /!-  *+!,.7A"G&L'O'S'[.d l)y} #$%P dialtime caught SIGALRMdialint caught SIGINTddinc entry n%s dial waitfor gotdidweget indreset resetting alarm and signal handlersdreset alarm and signal handlers reset WARNING - speed change to %ld failed. Speed changed to %ld. K_DIAL_DIRECTORYK_COUNTRYCODEK_LD_PREFIXK_INTL_PREFIXK_TF_PREFIXK_TF_AREACODE111011800888358199610119990000K_AREACODEK_PBX_XCHK_PBX_ICPK_PBX_OCPckudial dialfail%s Failure: DIALANSWERdial display is on%s: Timed out while trying to initialize modem. %s interval expired. DIAL TIMEOUTANSWER timeoutTimeout. dialtimeoutInterrupted. dialinterrupteddialfail()lbuf "" Call not completed. Call did not come in. dialError initializing modem. dialmodem initunknown dialunknownckdial dialhup failedSorry, Can't hang up communication device. Try 'set line %s' again. Initializing: %s... INSERT CALL TO WINDOWS TELEPHONY API HERE No response from modem, retrying%s... againckdial wake_str mdmstatATS7=%d%cckdial S7 mdmstatckdial default, wake stringckdial no wake_strckdial default, waiting for wake_promptckdial no wake_promptckdial got wake promptWARNING - I don't know how to turn on EC for this modem ckudia xx_okckudia calling xx_ok for ECckudia xx_okWARNING - Trouble enabling error-correction. Likely cause: Your modem is an RPI model, which does not have built-in error correction and data compression.WARNING - You can't have compression without error correction. WARNING - I don't know how to turn on DC for this modem WARNING - Trouble enabling compression WARNING - I don't know how to enable modem's HWFC. WARNING - Trouble %sabling modem's local flow control disenAPM1;KMC%d APM0 ATS111=0 ATS111=%d S112=%d WARNING - I don't know how to enable autoanswer for this modem. ckdial ANSWER waitctATS2=%d WARNING - Problem setting modem's escape character DIAL command + phone number too long! dialing Dialing: %s... ckdial waitct dial awaiting response, mymdmtypckdial modem responseVALWARNING - no carrier CNXINVINVCFIABAB: Timed outCBCB: Local DCE BusyETET: BusyNSNS: Number not storedNTNT: No answerRTRT: Ring tonePVPV: Parameter value errorPSPS: Parameter syntax errorMSMS: Message syntax errorCUCU: Command unknownFCFC: Forbidden callINCINC: Incoming callDLCDLC: Delayed callBusyNot connectedNot ConnectedNo dial toneNo Dial ToneNo answerNo AnswerAnsweredConnectedANSWEREDBUSYDISCONNECTNO ANSWERWRONG ADDRESSANSWEREDBUSYCHECK OPTIONSDISCONNECTEDDENIEDAU 1 dial df03 gotANERAttachedBusyDisconnectedErrorNo answerNo dial toneSpeed:)ON LINENO CONNECTOKBUSYNO RINGON LINEFAILED CALLCALLINGCOMPLETEFAILEDABANDONDEDNOT AVAILABLELACKS PERMISSIONNOT A DATALINEINVALID DATA LINE NUMBERINVALID GROUP NAMEBUSYDOES NOT ANSWERONLINE!Online!BUSYBusyDEAD PHONEINITIATINGBUSYCALL FAILEDNO CONNECTBUSYNO DIALTONECOMMAND ERRORIN USECONNECTPROGRAM ERROR - No response handler for modem type %d ckdial alarm offdial partialdial succeeded %sall complete: %s. Partial cC %sall complete. Partial cClongjmp returns to dial routineSorry, DIAL memory buffer can't be allocated Invalid modem type %d - internal error. Sorry, handler for this modem type not yet filled in. dial number%sDIAL lbuf malloc ok%sDIAL rbuf malloc ok%sDIAL fbuf malloc okSorry, can't open %sSorry, can't open deviceSorry, can't reopen %sSorry, can't reopen device/dev/nullSorry, Can't condition communication line Try 'set line %s' again %s; Waiting for phone call... %srying: %s... RetT Via modem server: %s, modem: %s Device: %s, modem: %s, speed: %ld , speed: (unknown) WARNING - interface speed %ld might be too high for this modem type. If dialing fails, SET SPEED to %ld or less and try again. %s timeout: DialAnswer%d seconds (none) To cancel: type your interrupt character (normally Ctrl-C). ckdialckdial timeoutVALgetok rbuf init okgetok ddincgetok:OK ERROR at atMDMECHO-t AT ATMDMECHO-Tgetok returnslongjmp returned to getok()getok timeoutgetok entry nGETOK rbuf malloc okabout to alrm_execute dook()returning from alrm_execute dook()RESPONSE mdmechoSPONGERESPONSE-ARESPONSE-Cdial hayesnv lbufdial hayesnv gotdial hayesnv numericdial hayesnv suffix Local phone is ringing! No Carrier. Modem Command Error. Dial Locked. No Dialtone. Busy. Dial Locked. No Answer. Ringing... Answered by voice. CONNECT 1200/75 - Not supported by C-Kermit Ringing... Dialing... No Prompttone. RELIABLE LAPM COMPRESSED CONNECT Can't change speed to %ld Speed changed to %ld CONNECT FAST/KERMFAST/KERM RRINGRINGINGDIALINGCONNECTOKNO CARRIERNO DIALTONENO DIAL TONEBUSYNO ANSWERVOICENO PROMPT TONEREMOTE ACCESS FAILEDFAXDELAYEDBLACKLISTEDDIAL LOCKEDRINGERRORCARRIERDATAdialhup mdmhup Modem hangup OK WARNING - modem hangup failed Hangup OK Hangup skipped Hangup error Hangup skipped mdmhup hup_strmdmhup escbufmdmhup esc_timemdmhup pause 1 OKmdmhup net ttslow okmdmhup pause 1 OKmdmhup ttslow okmdmhup calling response functionmdmhup hangup responsemdmhup no ok_fnDial Command, 6.0.091, 6 Sep 96UnknownTrailBlazerTrailBlazer-PlusT1000T1500T1600T2000T2500T3000QblazerWorldBlazerCCITT / ITU-T V.25bis autodialer,:VALCRN%s Hayes Smartmodem 2400 and compatiblesATP ATT ,ATQ0 OK ATD%s ATQ0H0 ATS0=1 ATS0=0 Unknown%s AT&T ISN Network DIAL%s AT&T switched-network modems,+at%s AT&T Digital Terminal Data Module%s Digitel DT-22 CCITT dialer,:HUP VALCRN%s HUP Hayes Smartmodem 1200 and compatiblesATP ATT ,ATQ0 OK ATD%s ATQ0H0 ATS0=1 ATS0=0 Hayes Ultra/Optima/Accura 96/144/288ATP ATT ,ATQ0X4N1Y0S37=0S82=128 OK ATD%s ATQ0H0 AT&K3 AT&K4 AT&K0 AT&Q5S36=7S48=7 AT&Q0 ATS46=2 ATS46=0 ATS0=1 ATS0=0 Hayes AccuraATP ATT ,ATQ0X4N1Y0S37=0S82=128 OK ATD%s ATQ0H0 AT&K3 AT&K4 AT&K0 AT&Q5S36=7S48=7 AT&Q0 ATS46=2 ATS46=0 ATS0=1 ATS0=0 Practical Peripherals V.22bis or higher with V.42 and V.42bisATP ATT ,ATQ0X4N1Y0S37=0 OK ATD%s ATQ0H0 AT&K3 AT&K4 AT&K0 AT&Q5S36=7S48=7 AT&Q0S36=0S48=128 ATS46=2 ATS46=0 ATS0=1 ATS0=0 AT&T / Paradyne DataPort V.32 or higherATP ATT ,ATQ0E1X6&S0&C1&D2&Q0S78=0 OK ATD%s ATQ0H0 AT\Q3 AT\Q1\X0 AT\Q0 AT\N7 AT\N0 AT%C1 AT%C0 ATS0=1 ATS0=0 Microcom DeskPorte FAST 28.8ATP ATT ,ATQ0X4F0\K5 OK ATD%s ATQ0H0 AT\Q3 AT\Q1 AT\H0\Q0 AT\N3 AT AT%C3 AT%C0 ATS0=1 ATS0=0 AT-J0 AT-J1 Zoom Telephonics V.32bisATP ATT ,ATQ0E1N1W1X4S82=128S95=47 OK ATD%s ATQ0H0 AT&K3 AT&K4 AT&K0 AT&Q5S36=7S48=7 AT&Q0 ATS46=138 ATS46=136 ATS0=1 ATS0=0 ZyXEL U-Series V.32bis or higherATP ATT ,ATQ0E1&N0X5&Y1 OK ATD%s ATQ0H0 AT&H3 AT&H4 AT&H0 AT&K3 AT&K0 AT&K4 AT&K3 ATS0=1 ATS0=0 Zoltrix V.32bis and V.34 modems with Rockwell ACI chipsetATP ATT ,ATQ0E1F0W1X4Y0\K5S82=128S95=41 OK ATD%s ATQ0H0 AT&K3 AT&K4S32=17S33=19 AT&K0 AT\N3 AT\N1 ATS46=138%C3 ATS46=136%C0 ATS0=1 ATS0=0 AT\N0 AT&Q0 Motorola FasTalk II or LifestyleATP ATT ,ATQ0E1X4\K5\V1 OK ATD%s ATQ0H0 AT\Q3 AT\Q1 AT\Q0 AT\N6 AT\N1 AT%C1 AT%C0 ATS0=1 ATS0=0 AT\J0 AT\J1 BOCA 14.4 FaxmodemATP ATT ,ATQ0E1F1N1W1\K5S37=11S82=128S95=47X4 OK ATD%s ATQ0H0 AT&K3 AT&K4 AT&K0 AT\N3S36=7S48=7 AT\N1 ATS46=138 ATS46=136 ATS0=1 ATS0=0 Intel High-Speed FaxmodemATP ATT ,ATQ0E1Y0X4\K1\V2S25=50 OK ATB1+FCLASS=0 OK ATD%s ATQ0H0 AT\G1\Q3 AT\G1\Q1\X0 AT\G0 AT\J0\N3"H3 AT\N1 AT%C1 AT%C0 ATS0=1 ATS0=0 Multitech MT1432 Series MultiModem IIATP ATT ,ATQ0E1X4&E8&Q0%E1#P0 OK ATD%s ATQ0H0 AT&E4&E7&E8&E11&E13 AT&E5&E6&E8&E11&E13 AT&E3&E7&E8&E10&E12 AT&E1 AT#L0&E0 AT&E15 AT&E14 ATS0=1 ATS0=0 AT$BA0 AT$BA1 SupraFAXModem 144 or 288ATP ATT ,ATQ0E1N1W0X4Y0\K5S82=128 OK ATD%s ATQ0H0 AT&K3 AT&K4 AT&K0 AT&Q5\N3S48=7 AT&Q0\N1 AT%C1S46=138 AT%C0S46=136 ATS0=1 ATS0=0 MaxTech XM288EA or GVC FAXModemATP ATT ,ATQ0E1X4Y0&L0&M0\K5 OK ATD%s ATQ0H0 AT\Q3 AT\Q1\X0 AT\Q0 AT\N6 AT\N0 AT\N6%C1 AT\N6%C0 ATS0=1 ATS0=0 IBM/Siemens/Rolm CBX Data Communications Module MODIFY?CALL %s US Robotics Courier or SportsterATP ATT ,ATQ0X4&A3&N0&Y3 OK ATD%s ATQ0H0 AT&H1&R2&I0 AT&H2&R1&I2 AT&H0&R1&I0 AT&M4&B1 AT&M0 AT&K1 AT&K0 ATS0=1 ATS0=0 Telebit TrailBlazer, T1000, T1500, T2000, T2500ATP ATT ,AAAAATQ0X1S12=50S50=0S54=3 OK ATD%s ATQ0H0 ATS58=2S68=2 ATS58=3S68=3S69=0 ATS58=0S68=0 ATS66=1S95=2 ATS95=0 ATS110=1S96=1 ATS110=0S96=0 ATS0=1 ATS0=0 Telebit T1600, T3000, QBlazer, WorldBlazer, etc.ATP ATT ,AAAAATQ0X2S12=50S50=0S61=1S63=0 OK ATD%s ATQ0H0 ATS58=2S68=2 ATS58=3S68=3 ATS58=0S68=0 ATS180=3 ATS180=0 ATS190=1 ATS190=0 ATS0=1 ATS0=0 (dummy)%s Generic Rockwell V.32 modemATP ATT ,ATQ0X4W1Y0%E2\K5+FCLASS=0N1S37=0 OK ATD%s ATQ0H0 AT&K3 AT&K4S32=17S33=19 AT&K0 AT&Q5\N0 AT&Q0\N1 AT%C1 AT%C0 ATS0=1 ATS0=0 Generic Rockwell V.32bis modemATP ATT ,ATQ0X4W1Y0%E2\K5+FCLASS=0N1S37=0 OK ATD%s ATQ0H0 AT&K3 AT&K4S32=17S33=19 AT&K0 AT&Q5S36=7S48=7\N3 AT&Q0S48=128\N1 ATS46=138%C1 ATS46=136%C0 ATS0=1 ATS0=0 Generic Rockwell V.34 modemATP ATT ,ATQ0X4W1Y0%E2\K5+FCLASS=0+MS=11,1 OK ATD%s ATQ0H0 AT&K3 AT&K4S32=17S33=19 AT&K0 AT&Q5S36=7S48=7\N3 AT&Q0S48=128\N1 ATS46=138%C1 ATS46=136%C0 ATS0=1 ATS0=0 IBM Mwave AdapterATP ATT ,ATQ0X4Y0&M0&Q0&N1&S0\K3\T0%E2S28=0 OK ATD%s ATQ0H0 AT\Q3 AT\Q0 AT\N7 AT\N0 AT%C1"H3 AT%C0"H0 ATS0=1 ATS0=0 Gateway 2000 Telepath II 28.8ATP ATT ,ATQ0X4&N0&Y1#CLS=0S13=0S15=0S19=0 OK ATD%s ATQ0H0 AT&H1&R2 AT&H2&I2S22=17S23=19 AT&H0&I0&R1 AT&M4&B1 AT&M0 AT&K1 AT&K0 ATS0=1 ATS0=0 Cardinal MVP288X SeriesATP ATT ,ATQ0X4W1Y0%E2\K5+FCLASS=0+MS=11,1 OK ATD%s ATQ0H0 AT&K3 AT&K4S32=17S33=19 AT&K0 AT&Q5S36=7S48=7\N3 AT&Q0S48=128\N1 ATS46=138%C1 ATS46=136%C0 ATS0=1 ATS0=0 Cermetek Info-Mate 212 ABbPpTt XYR D '%s' Digital DF03-AC=%sDigital DF-100=%s#Digital DF-200=W d %s GeneralDataComm 212A/ED% $D :T%s Penril modem >k :%s Racal Vadic VA4492EKk *D ?%s Ven-Tel% $K Number to call: %s Concord Condor CDS 220 2400b, CDS >Microcom MNP modems in SX command modeDP DT ,!@SE0;S1P4;SBRK5 !D%s SF13 SF11 SF10 BAOFF;SMAUT BAON;SMDIR COMP1 COMP0 AAMicroLink 14.4 or 28.8ATP ATT ,ATQ0X4\K5 OK ATD%s ATQ0H AT\Q3 AT\Q1\X0 AT\Q0 AT\N3 AT\N0 AT%C3 AT%C0 ATS0=1 ATS0=0 \J0att-dataportatt-dtdmattdtdmatt-isnattisnatt-switched-netattmodematt-7300att7300bocaccitt-v25biscardinalcermetekconcordcourierdataportdf03-acdf100-seriesdf200-seriesdigitel-dt22directgateway-telepathgdc-212a/edgendatacommhhahayhayehayeshayes-1200hayes-2400hayes-high-speedhayes-accurahayes-optimahayes-ultrahst-courierintelitu-t-v25bismaxtechmimicmicrmicromicrocmicrocomicrocommicrocom-at-modemicrocom-sx-modemicrolinkmotorola-fastalkmultitechmwavenoneold-telebitpenrilppiracalvadicrockwell-v32rockwell-v32bisrockwell-v34rolm-dcmsportstersupratapiteteltelebittelepathunknownuser-definedusrusr-212ausr-courierusr-sportsterusroboticsv25bisventelzoltrixzoomzyxelPrecvseqexpecting sequencegot it (null sequence)received sequence: returning with got-it codesending sequence EOTBREAK\b\B{BREAK}Sorry, can't open %sExecuting SCRIPT through %s, speed %ld. SCRIPT string: Sorry, Can't condition communication line Script successful. Script successful.Sorry, script failed Script failedScript Command, 6.0.028, 8 Feb 96Network support, 6.0.077, 6 Sep 1996Day Mon 00 00:00:00 1900 SunMonTueWedThuFriSatJanFebMarAprMayJunJulAugSepOctNovDec/lib/dst ((((( H II*/dev//etc/utmp/...getwd: can't open ....getwd: can't chdir to ..getwd: read error in ..getwd: read error in ..//getwd: can't change back to ..Unknown error: /bin/shsh-c-p/bin/shsh-c/lib/ttydevs/dev/ @Ff@Hjj/etc/passwdrr@ BCzEG@HPtJ$LM nO(kQRC@hTV*W cY_1[\.^^k v:@ `#ljaxbXc&zexn2fh ?WShΡ[u+p%ľMO E9} <d<"EYȘ2*$<2"5"8 :<B"DFH JOT$l_"dfi$9rt0$g"$qT"$"" """"$,""$"" $ $$%$$6)$4$V@$K$eQ$\^$f$q${$$, $$` $SP $2(&0;;dE̘28 yh  l y|  % - 6 ?yGyOyTy[ybyiypywy~zz zzzzz$2"$$$  $>$  $"$ #(0+4.019 A"8C4H0K",Mb(S"U$o]"d$ko!xz}$$ $e 2D" $ 2D""bbN"" $} !2D p!$ p!2D%*1( 79$3!?EK RTW$H%af$%kqvy{$X( $,+ $|+?z  $ -$.$/$#/$./ $|/$  $l1&$($*$226$2=2E$2L2DSVXZ$)3`$53fh,l@ n@ p$_4u,wy $5$7,   @ @  $<(=$=(=2D$= $=$=$>%$>,.$?46=(@$PH?FI$<@OSU$4A\`$ Bg$Bmo$Buw"y$B"$ C$'LC"$6tC& $TC  $(E$`E($E$ E    $+!E#'$!F/$!F8<$!TGE$"hGN"SY[$)"Gdfh$4"Hq$9",Hy& & & & & & & (l?z& (bz(z(z(z( z(z(z(y(y(y(y(y(y& & & %& *&| .(dy4&$h :(yA&8 H#iHQ#lHZdlHcE̘2kr w@~D~G$lH$>H"$I"( (b$K$M$$3M"  $dN" $tN$O  " $P  " $Q  "   $@Q& ( * @ , $Q5 7 $:R= ? $gSE "J $L  P $DTV "[ " ] _ a $Uh "m $Us "x "~    "  $&V "   " " $IW " " "  " " $X " " " $@B,E$FlLN$_U"W" Y`"e$Tj"l(o q"su$Hz$x" "" "b$H $p,$,$<,$$/ "$, " $ b $8 "}((#(*(1(9(A$_ IK$q <S"Xb]e$ l2Ds"${" " "b$" " b"4$r 42D"b$ @"b$ " ""$5 "!"("+$W 2"4"68 :>$ ELR Y$ b"di&(p&(w&(}&(&(&((b}(,y&(&(&(( x(t(p(bp($l("h&(= = dE˘287$$(* 4;>@C EGO$U$] `cegi ksx$ ~ @ @ $,      $ 8 $Bx , @, @,  @ $, @ @, $,@ @ !@, %$\*,.5@7@ ;@ =@, A$HJL$3P$8VX,Z\^$Rce$Wj,l$eqsu$|~ $],$uL,$}$ &,<8(l$, &,D8&,@8$""   $ ,l"& -24@7@ 9@ ;@ =$9DFH, JbO$JHVY"\$pc&l87i~r~{dE-̘2$ $, (( ,$6$LX$a $y $  $p $| !#$,02$$9;B HMQ$JdZ\^$dgik$qtv z|~ FFF$n""$},, $,(@"<(b&&"F&"F(b(b(b(bb8 " $/4%($Z&"( $(&"((+"-" /" 1(:5<>$,E,I$-O"TbpZ" `fhFp$F.v"{(~( "$p/($y$0$0&F&F&F&" Fi2l2dl2EX̘2l2l2dl2 E˘2UU U'U1d4h7$l2< >A D F HxRxTtX,pZbk]bJ`b)c" f" i nsbvby"~" " ""  " $Sr"@ BDF@}O$@}W2D_a"e" jn"Dq@t"<w"8z"4|"0~",($  b$P$p$7L"$E"$M$ ""$kl$$$t"$,$ "$"" $$&$("*"-" 0"24$L:"?"D G$IKdS"X" ["]_$he"j"o r$w$y$"" $"$$"" $"$(("$"$%"$"$-,($"$" """ $""  $"""" !#$@ )"."3 6$8" ;>@$ `F"K"P S$U"WY(\"_" bdf$* l(rt" y"~$$/ D(" "$$; p(" ""$$" " $ (""$. \$ خ$ (2D$'%*"$.@7$: CI"LTZ `fh$ o2Dv"y}$ d2D" ""$ l"$ 2DԾ$Ծ2D$62D$Y2D$q@2D$p%'"),2 8:<$BD$K"M OQS$$Y"[]$Gd(j"n p$ry }$j$(" $$~$((("("("&f&f&f("("|("x("t&f&f&f&f&f&f"&f%.7d@Eɘ2HrN$Tr\tdtltut~u@uduhuuu vvvvv v$v(v |zG zP zX z_ d{i x{q {y { { { { | ,| @| | | | |  } D} X} t} } }!}!~!(~!!$$'!*!,!.!$u3!"5!7!$=!?!A!C!E! G!I!K!~U!~^!~g! p!y!!!!4!Ԁ!! !,!D!!0!$ (!!!!$^ !!!&!&0"& "&D"&,"&  "&("&Ԁ0"&48"&?"&F"&M"&U"& ]"&~e"&~m"&~v"&(~~"&~"&}"&}"&}"&t}"&X}"&D}"& }"&|"&|"&|"&|"&@|"&,|"&|"&{"&{"&{#&{ #&{#&x{#&d{!#&z'#&z.#&z6#&|z>#&yD#&yL#&wU#&v]#&|vf#&`vo#&$H$ȉP$Y$(c$Xl$pt$|$ $<$T$l$t$`$$a`$2D$$bk$i$h$(d$b`$`$ $"$$$ $$$$$%2D %bk%bJ%b)'%")%+%$J3%8%(:%B%$xI%2DP% R%T%V%$_%"c% e%g%$tm%o%q%z%$%2D%%"%"%%$L%% %(%$)L%,%% %%%$,%2D%%8%4%%%" %%%$/%% % %%(%%&$ &2D&&,&(!&b"#&&&"(&*& -&0&5&$ =&"?&B& G&I&K&W&$ b&2Dm&"u&"z&" }&P&bL&"&&$ &2D&"&"&"&"&"&"&b&bt&b,&b&b&bT& &&$` T &&&$p &&&b.&$& &$&# &H&"D&b@' '"' ' ' '''$D.'' #'%'''$\0.'0'&ht8'&hl?'&hTG'&h N'&hU'&hp\'&hXd'&h(m'&u'&hȉ|'&h'&h '&d'X1'X1'dX1'Eɘ2' ''8'h'$,X1''''"'b'"' '''($h4 (($4(( ($G4)(+(1(3($6;(=(?($6H("J(L(,N((P((V("(X((Z("$\( e(l(n(p(r( t(w($~($<((((" ((($$>("(((($9?("(((ȕ($X@("(((($n@A("(((("($8B(("($xB( ("(($ZF)$MF)$R G)"))$_G) ) )$L()*)",)$ P4)"6)$g U=)$o UD)H)M)@U)])@e)m)Yu)$ Y|)2D)$ lY)))t)p) i)"h)"d)`)d\))))) )))$ |^))") ) )")")") )))$5 T`)"))("@))*` *$K `*2*"** * "*$*&*a.*$y a5*2<*"?*D* I*"L*TN*`Q*\S*XW*QY*X[*T]*T_*"Xa*Tc*Tj*Xl*Tr*Tu*Qx*"X{*T*T*\*dX*X*"T*V*U*"T*"T*"T*T*"P*"L*"H*"D*=*<*$* ***** ***D*$**"*$*"**"**(*"* ***$̑+" + +$ ++&++b$+"D(+"@++"<-+"8/+"41+"05+",8+%;+$@+ D+F+I+N+Q+ T+V+X+(_+&"hb+&8i+&p+&b z+(bD+&b+&+(l@+&+(l@+@ +@ +d +E:ʘ2+\++$ +++$p+X+bT++ ,,,$ȟ ,,,$,",,", !,$,&,$,,"1,"5, ;,=,?,$(ܤF,"H,J,( L,Q,(T,"$^," b,"f,"i,"l,p,s, u, |,,,$t,,,"$," ,,",,, ,,,P,T,,T,$T,2D,",,,,d,$d,2D,,$--(-(-$@-($-( --"- -"-$-$L--"/-6-<-B- D-G-I-$4 P-"R-T-$Z-(`-"d- f- m-o-q-$Լx-(~-"- ---$P-"--"- ---$Ծ-"-"-$-$--"---- ---$X 0-"---"- ---$ X---$ ,- --(.$ .$ .....$` d&.(.$g /.$ 6.<.A.$PH.L.P.$Z.,\. _.$,j.l.p.t. w.,y. |.$.".$ ...b"..".".".(.". ...$.$.".". ...$|.......$ /2/" / //$+/2B!/\%/X+/"T./bP3/:/$m@/2DF/H/J/O/V/ ^/$ e/2Dl/t/{/\/$\/2D///4/$4/2D///\/$\/2D/t/$t/2D/////D/$D/2D///0/$002D0H0$H02D0$$0"&0(0"*040$+=02DF0O0$BW02D_0$Pf02Dm0p0$c@y0{0}0 000$L0"0$0$ 0b20b"0b0" 0"0"0"0 0 000$0000$(0"0$0$ 00 00"0$<0"0$0 0"0b0b0$Z@1"11 1 1b1$z1"11 #1(1.1012141 6181":1$ ?1A1"C1 I1K1 Q1$F$X1\1a1"e1"h1"k1" m1p1s1$x1"z1|1$1$1$1"111&1&1&1&\1&" 1(1(1(1("1(1&1&1("1(bT1(P111d2Eʘ2 222 2Ğ2Ȟ2$5 2#2bJ'2"H+2bD32=2$$ D2G2bAO2$ @ U2X2HZ2"D^2b@f2̞l2Юs2Ծy2 2$r2$w(22$d22"22"2T2$T22D222"2"2"2"2b2b2b2"2b22b2",2"(2"$2 2"3"3"3 3 3333$ 32D&3"(3(*3 ,34/3013(,43(93"<3"A3$H3"J3M3dU3"`Z3(\\3"X_3Td38n34u30z3,3(3$3 3333 333 3$>$3383<34303,3"$3" 33333 333$(04" 444 4b4$0 14"!4$K42*4,4.4$$44474$ 5>4$* X6G4"J4"M4$Y 8S4"V4 Y4\4_4$ =e4g4$J @o4"q4t4 w4z4}4$ A44,4"(4b$444$ E4$M F4"4"44$ TI4(4"4 444$ N44"4 444$ \V44"4b 444$V Y4"44"h4"d5`5\5X 5"T 5bN555 5"5 $5&5(5$ P^05"2545$ ^;5"=5?5 A5C5E5$4`J5M5O5 R5U5"0X5b,[5(]5b!_5"a5"c5"e5"g5"i5 k5m5o5$8trv5"x5&" 5& 5(dԾ5(Ю5(̞5("Ȟ5("Ğ5& 5(5(5at5at5dt5Eʘ255*555D*5h*5l*5t*5*5*6+ 6+6,6,&6--6$t36$7696;6$tB6$F6H6 J6N6$uT6"Y6$]6"d6 f6h6j6$(wq6 s6u6$Tx|66b6( 6"66$h6$U 666b666$iď6$D6d6$d62D6 6"66 6$ 62D66"6"667 77 7$Q77"T7"P7"L7bJ7b#7bI'7bI+7"H.7bB37"57 =7?7A7$ H7"J7L7$dR7Y7\7$Sc7$Yj7m7p7"(x7b!7$D7"7777b77 77( 7"7$z77(7"7 777&h-7&h,7&h,7&+7&h+7&h*7&*7&ht*8&h* 8&hD*8("8(8&*8(8!8*8d38E0˘2;8DC8DK8$U8$f\8^8$txe8g8$m8q8$w8,y8}8$8"8$L8"8"88$88"8" 8"8"8"8dE8$Bt8"888" 8"8"8$w888"8(b48$л8"89"9$4 9 99$Z$99$ 9"9"$9(b<)9$%\1959$il:9<9"?9" B9D9F9"I9(bFK9$R9U9 Y9\9_9$^f9h9lEp9rv9|9pE9tE9xE99$92D9$ 99@9<9894909b,9 999$3999 9"9T9bP9$9"9$:"::$N :::$":$(:|E/:$<7:9:"<:" ?:A:"D:&"|EJ:&xEO:&tET:&pE[:(b`:(bre:&lEl:&"dEs:&"Dz:&D:v:x:dx:EX˘2:x:$x:2D:"::$:2D:":$:":":b:$::$d::"::: ::; ;d;EȘ2;Y%;Y.;1;4;4[7;:;gB;jJ;jR;kX;ka;kj;$2p;s;u;w;(|;(;";;,;"(;b$;;" ;;;(;;" ;;";b;;(;";;;&hk;&k;&hj;&hj;&hg;(";&4[;(;(;&Y;&hY<AW$ <AX$<dX$<Ef̘2'<|2<=<E<L<U<\<f< m<u<}<<<<$<.<<<<<2<<6<<:<Ȇ<̆<І<$kX$<<x&=$x& =2D===>#=&,=$&4=2D<=@=&K=$&U=2D_=fh=L'q=$L'y=2D===)=$)=2D==$*===$*======Ԇ=+=$+=2D===,=$,=2D> >" >,>l&> >E>$>&>$2->3>:>@> C>E>G>$X?N>&؆U>W>$@]>_>a> c>$Ek>2Ds>u>&"Ԇz>(~>(">(df>(d>>&І>&̆>&Ȇ>(:>&d>("6>&>("2>&">&">&">&>(".>(b$>&>&>&>&>&?(  ?&?&?& ?&,&?&-?&7?&|A?fEJ?hES?dhE\?E̘2d?Po?z??T?X?\?????d?ܔ?,}?T?̕?D??4@ @$@@"@,@5@|;@B@lK@U@\[@Ԝb@Lm@ĝt@<}@@,@@@@ @@@t@@d@ܣ@T@̤@D@@4@A$AAA&A-A6A9A?AEALAUA]AhEgA$3 hEpA2DyA}AEA$b EA2DAAEA$ EA2DAAFA$ FA2DA"AA\FA$ \FA2DA"A A AFA$ FB2D B" B"BBBTGB$ TG#B2D*BG2B$ G9B2D@BBBEBHMB$ HTB2D[B]B$9 DHhBjBlB"nBKxB$ KB2DBB"BBBBBBNB$ NB2DB$Bb$Bb,BB"B"B"B~BBBBBCC C C" C"CCoC$Oo'C2D0C$;C$eoBC"FCIC LCOCLQC"HVCD]C"@_C"8cCb2jCqC0yyC$0yC2DCCCC#CPyC$PyC2DC$C CC C|C$V|C2DC$C$],}C2DCCC$z~D2D D D DbDDD$D2D$D +D"-D"2D$th:DH(lDH("hNH("dVH("`\H&cH(l`jH&qH(l`xH(d8H(4H(0H(",H(b,H&H((HpHpHdpHEs͘2H$!pH"H$H H$%H$)H$-H$1I$5ԥ II$>II$BI"!I#I,I5Id>IE͘2FI$_QI$XI$_I$ hIkI$HxI$II$ I$I$I$ III$I$II$ I$I$I$ IIIR/JR0 J8JHJT%Jq,Jt5J=J EJ0MJ@XJy\aJliJ|qJhyJhJhJJJJJ(J@JJJ̴JyĶJJJL`JfJKr KP(K!H!KX,K7K@KлHK,PK<YKh`KxgKoKwKKPKdKtKKipKKpKKf@KPKXKKKKKyPL` LL(L8'LH/L9LX@LhILRL[L!dL$(nLxLL(L<LH`LL0LXLhLLLLLLLXMX MMM&M 1M+:MEMXNM VM(_M(eMkM~P qMrzMMWM MYMeMM0Mp4M8MlMBMMM\MdM5M9NG NNN!N+N5Ne?NyHN4RNXN^NfNKnN vN ~NQNNNy N$N(N,NH0NK4NB8N<N@NDNHNLNPNTNaXN[\NV`Ohd O hOlOp#Ot+Ox3O|;OXCOiKOkSO[OcOkOsO{O O8OHOKOOOOOO#OCOIO OOOOwP} PPPj"P *P0P5P;P CPKP~ SPu\P" fP$oP(xP,P fP`lPpPZtPxxP|PPP P<PP P P P )P +PTPDQ Q Q Q$Q,Q 4Q \2T9TAT]MTASTZTbTjTsTxyTMTTTT*T T TT TT 88T T$T(T,T0UP4 U8U<U@'UD/UH7UL?UPGUTOUXWU"\_U&`gU,doU/hwUTlU=pUtUxU5|U(UU0U 8<U %@U 5DU HU KLU fPU TU (XU D\U `V<V$V!V7+Vkl7V<@V'JV3<RV^]VgVoVTyVV,VyTVV!V\VH<VVHrVjLCV4VVVpV`ȟWStWWhW6$WԾ,We2Wz[:WJ BWtrJW SW[WtfW^, sW` ~W&WX1WnW Wi2W(WлWE W( W3, WD W=WNBW|+WiWDHXXXUX"X,<@)X 4X @X| FX NX$ UXu0 ]X#4 eXm< lX]@ tXH }XL XP XcT X X X\ X` X<d Xp Xt Xx X2 X X BXS XX~,HXrY &Y YY &YE0Y.`6Y?Y4/GY?H?NY8VYLbYjYqTpYyYHY`YY YY;0Y[YFYFYpYYGYxY,Y'`EYhGYqZZ=ZdZ@"ZpH*Z.l1ZyX9Z@Z GZxMZhSZ!ZZtX(bZ6H%mZ"%sZ~,+|Z7 -Z.Z/Z/Z /ZZ_1Z2ZK3Z 3Z 4Z5Z7ZZg<ZJ=Z=[H [[b>[(![>)[)?0[@;[ D[2AL[o BT[FB[[cBb[c Cj[1tCr[MCz[(E[E[E[[L[Ż[P[P[([TG[G[H[[[b[[\2 \%\\%#\+\3\l;\C\L\V\Z\$a\(j\glHr\M{\H\R\tĶ\\\I\\K\Q\\\ `\=M\N\\*M\BN\W\XO]`]P](Q]x@Q ]f̴)]P̵1];S8]X>]8F]ADTM]p{T]@U\]PUc]&Vk]&Wr]`{].X]bhԒhhؒqhyh2h h ]0hhhxhhhZh9bhbhth 4hXEhPP^hLhxi|idi6 i0)i*3i>iGiQi\ifiqi{ii0 ii)i-ii4i#iLiiĩi@tiV`i)\itjP jIpj_hjW)j"t1j3`:jmDjOjJXjh aj; jjsj(|j>̓jNējRjjMȓj1ГjnԓjcؓjfܓjZjj js jjj Gk[k_ [k,[$k/-k~6k 8>k z<Hk,Tkc4\k/ekmT nkq uk3d|kkkkk @k DkTkhEkYk_k@AkukYkxkw[k Hk<l L lYl PlY!lh)l$0lAPE8l TYlOh4l4lH2l )\l `llll*mB6mYmYmY&m7Y-mY4m*=m<Dm>Lm@Tm?\m hdm ,hlm htm `h|m?8BmZxBm|mmFmXFmGm[mU mLmL+m++mPm2dmUnUnnlYn [#n h",n5n=n l"Dn[OnWn9[bn|^knT`un p"|n x&n p(nLnn p2n 2nkn vP3nn T3n MX3n:n GX4n X5n@n 5n 6n H6o 6o4o8)o 870o.P:o\`AoUdHoQhPo9l\o|pfotoo7yo6oqo P8o T8o -X8o u`8o `9o `:oo +:ok o :oXoPoX@ono,ouܤp p; p\p$%p-p :5pfb=pbCp8[KpRpn]p@fpnp(xp0p|p/ԼppzYpVxpXpHpp{p pp#p6Dp pp|qx qYqq@!q :)q$$1qt 7qIBqKqUq \q<aq@iq|oqXvq {q q ;:q >;q hd;q1qR$ q@ qM qq(qdq9*qlq $qlqoq(0r0 1ry42r"$4r=5!rX6+rD82r5=9r{AArEJrFTrA\V[rTIcr6NjreYrrXzrf`r*r*r*r@*r*r>H+r+r^+rh,r.,r,r?,r,r -r\-r`-s*x- sX|-s-sF-"sd.(s:h.1s.7s.?s /Es<$/MsuGuOuZuCdu9nuYxupu/u}uIuu=ԥukutuuW|u,uOhu Iu Yuuquv vvv%v2v0?vXXGv?NvXvh]vivsv }vPvDvvv\vv+v7vLvivvG,v[v@vXv wwww X"w*w1w i=wIw_Sw iWw y]wewkwrw({wwwwwrwJFw  wwwwcrt0.oexitckcmai.ockcmai.cvaxpcc2ckindexs1s2tricasesxjilen2len1isabsolutepathxrcis_a_ttyn_nxxsysidsgetsysidsigetsysixsiinitprotoyupbstruptstrsndbstrsndtstrrcvbstrrcvtstrmakestrpsqxxxstrcmps1s2nt2t1docmdlinethreadinfofailcmdlinefoodotakeinithreadinfofailtakeinithreadinfodoicpthreadinfoxfailicpthreadinfodocmdfilethreadinfofailcmdfilethreadinfosetprefixzvalimainargcargvgetiobsnxxsysidsckcmai.cckutio.ockutio.cvaxpcc2_ttpmsk_tcount_saval_jcshell_sjbuf_lkf_cgmf_xlocal_curcarr_netconn_escchr_xclock_ftp_ttold_ttraw_tttvt_ttcur_ccold_ccraw_cccbrk_tdold_tdcur_tchold_tchnoi_tcharf_ttnmsv_xxlastxxlastxxlastscitimerhfoocctrapfoottgwsizsysinitxsyscleanup_ttotmottopenttnamelclmodemtimoxxx1x0_ttlock_ttrpidpxpidxxpcnamexdo_openttnamettclosfoo_ttunlckxxxtthangxttresxttrpidttrpidnamepidfdxttlockttlockttdevlockdirtmpnamlockfildevnamedevicetriesfpidpidlockfdxttunlckttunlck_tthflowtthflowtthflowflowstatusattrsxttpktspeedxflowparityss2ttsetflowflowttvtspeedflows2sttsspdcpsoks2scongspdspdt1ttgspdsss_mybuf_my_count_my_itemmygetbufmyfillbufxavailttfluinttfluxttfluo_jcconbgtflagosigintctpgrpmypgrpyxconintfssig_ignfooconnoi_in_chkin_chkin_chkfdnxttchkttxinnbufcxttolsntrieslenxttoccxxttinldestmaxtimoeolstartturnxxjflagccnnihavelenlplenpktlenttinctimoxxn_sndbrksndbrksndbrkmsecttsndbttsndlbmsleepmxrtimergtimerxztimesxclocktpcongmfdconcbescxconbinescconresconoccconxoxsconolslenconolasiconollsconchkcontypconinctimoxxchnttscarrcarriercarrctlttparcarrierttgmdmpsuspendflag_realuid_privuid_realgid_privgidpriv_inierrpriv_onpriv_offerrpriv_canpriv_opnnamemodesxpriv_chkyxreal_uidttimoffprivgidrealgidprivuidrealuidjcmy_itemmy_countmybufttotmottnmsvtcharftchnoitcholdtdcurtdoldcccbrkccrawccoldtttvtttrawttoldescchrnetconncurcarrxlocalcgmflkfsjbufsavaltcountttpmskckutio.cckufio.ockufio.cvaxpcc2_iflen_pid_fcount_nambuf_zmbufzkselfzopeninnamezopenonnamezzfcbpzclosenx2xzchinncxazsinlnsxoldzazxinnsxzinfillzsoutnszsoutlnszsoutxnsxzchoutncnzoutdumpxchkfnnzchkinamexbufzchkonamesxizdeletnamezrtolnamename2acasenflagp_workzstripnamename2nppcpzltornamename2dotpdcppcpzchdirdirnamsphdzhomehome_cwdbufzgtdirbufzxcmdfilnumcomanddefshellpshptrshnameshpathoutpipeszclosffilnumxwstatzxpandfn_fgentnampznextfnzchkspafnznewnfnsmaxpowerkjitndlenypxpbpbufzrenameoldnewqxspzcopysourcedestinationqxspzsattrxxk_datbufzdtstrtimessyytime_stampzfcdatnamebufferzstrdtdatelentbptimezonetime_stampsmonthdaysisleapyearnidaystmxzstimefyyxtmtpsbrzmailpfzprintpf_scratch_oldmtchs_lscmdshxpandpatnamlstlencretcodexiqpfgbuf_sspace_ssplen_freeptr_resptr_remlen_numfndsplitpathpiprvcurheadfgenfgenpatresarrylen_traversenextsptrheadtraversetraverseplsofarendcur_addresult_matcheosstatbufdirbuffdaddresultaddresultstrlmatchmatchpatternstringqssavepsave_whoamiwhoamiwhoamipcenvnameloginnameruidrealnametilde_expanddirnamejitempoldrealdirolddiruserzsyscmdsstatusshpidzshcmdsdefshellpshptrshnameshpathqstatistatchildwstatpidiswildfilespecpxcisdirsstatbufxzmkdirpathzpxctpxpzfseekposzfnqfpfnamebuflenbufpfnfpxpyxworkzmbufnambuffcountpidiflennumfndremlenresptrfreeptrssplensspacelscmdoldmtchsscratchdatbufcwdbufckufio.cckcfns.ockcfns.cvaxpcc2_fncnam_memptr_funcptr_cmdstr_drain_first_t_ebqsent_lsstate_lsquoteencstrspslenrcmputsrvccputtrmccputfilcc_xdbufzdstuffcdecodebuffnxlateczccpflgssflgtb8a8a7afnbuflslookbigetpktbufmaxxlateznxxcqxxssxxrcxxdlxxlsleftovera7xp2p1odp2odpdprnextrttinitxpktinitrinitdtpresetcfnlistsinitmxptpxsipktckrpxsinitkrcvfilntdirflgdirpreoffyycpxreotsfilextqpspktnamsdatalenxiszeofsseofssxeofsxseotrparxipsparsitpxlpsizyxgnfilefullnameretcodeyxisndhlpp_funcbuf_funcnxt_funclen_nxpnd_ndirs_nfiles_nbytesnxttypecsndtypefilename_nxtdirnxtdirnxtdirendlineblanklinesecondsminutehouryeardatemonthlendstrpnamesnddirspecrcnamep_nxtdelnxtdelnxtdellenpnamesnddelspecnamecwdvdirdirpcddsyscmdprefixsuffixcpremsetspyxlenadjpklpktlenslotsbufsizwhoarewepflagnbytesnfilesndirsnxpndfunclenfuncnxtfuncbufxdbuflsquotelsstateebqsenttfirstdraincmdstrfuncptrmemptrfncnamckcfns.cckcfn2.ockcfn2.cvaxpcc2_p_tblrttinitigetrttnakstatenrttdiffsqoldavgzzzyyyxrttdiffinputnak2acknfpizkyxacktypetypedoparchachparchksstartns3s2s1s0chktimotimoflagplenyxzcpsspackpkttypnlendxcrcmydatacpcopylongpktlpxkjichk1pktchkpktchk2pktmchkpktchk3pktparitymcrccpktnxtpktnjackacknsnskjacknnack1snackniresendnbctusavbctlsavxkjerrpktreasonyxscmdtdatsrinitregetretrievekstartchrcpbufzstartchpmatchstrchkspktbufstypechklenbuflenrpackesohppbccrcchklentypeklpxjilogpktcnsplogtstatslxtpfstatsp_tblckcfn2.cckcfn3.ockcfn3.cvaxpcc2inibufssrxzsizemakebufslotsbufsizbufxxxsizeiamksbufslotsximkrbufslotsxiwindowngetsbufnigetrbufifreesbufnifreerbufinfreerpktseqkchkwinnbottomslotsprevtopdumpsbufxjdumprbufxjsattrxpxalnji_refused_reason_nreasongetreasonspcrsattrspzngattrsyyretcoderprpbufspbufdsbufidbuftsbufdtbufftbufabufialnffdcinitattryyadebufzzopenafzzqpefcbdisposxcannedbufopeninamexnamename2filnox_isopenopenonamezzfcbchannelname2opentzzclsifxclsofdispxisopennreasonreasonrefusedckcfn3.cckuxla.ockuxla.cvaxpcc2ckuxla.cckcpro.ockcpro.cvaxpcc2_vstate_vcmd_reget_retrieve_x_swartxb2b1xx_sgetinitilenpf3f2f1n2n2len2len1f2f1str2str1n2kqpnncxxsactnocproto_xxprotoxxprotoxxprotolenstuff2stufftmpbufslxxsgetinitsgetinitregetsxretrieveregetvcmdvstateckcpro.cckucmd.ockucmd.cvaxpcc2_blocklvl_linebegin_quoting_psetf_cc_dpx_inword_hw_hc_hh_hx_atybuf_filbuf_cmprom_cmprxx_current_rlast_recall_bp_pp_np_ungw_atxn_testtesttestxmkwdhelpsnpatprepostoffbxs2pxpaqpbn2lckjiheightcolsccwidthsh_sortsntjim_filhelpfilhelpfilhelpnprepostoffbxs2pxpaqpbrcn2lckjiheightcolswidthfilbufcmsetupcmrininicmsetpscmsavpsnpromptfnsysxpushcmdcmrescminidcmpushcpcmpopuntabscmnumxhlpxdefradixnfpzqzpsxcmofixhlpxdefxpfn_setatmdirpzqsxcmifixhlpxdefxpwildfcmifipxhlpxdefxpwilddpathfcmifi2xhlpxdefxpwilddpathf_gtwordnsscptr_addbufsckjisdirpsvzqspyxcxcmdirxhlpxdefxpfnstpdirpzqxcxcmfldxhlpxdefxpfzqxcxcmtxtxhlpxdefxpfpxxczqxxixcmkeytablenxhlpxdeffcmkeyxtablenxhlpxdeffcmkey2tablenxhlpxdeftokfpmsgzzzqxpxczzzytlichktoktlistpcmcfmxcxungwordgtwordgtword_cmdgetc_cmdnewli_cmdchardelcxcpx_cmdechoqfbracelvleintrcpcommentchsrcechofquotecaddbufaddbufcplensetatmsetatmcpflagnbracelvlxpaprdigitsscmdgetccmdgetcc_cmdclrscncmdclrscncmdclrscncmdnewlcmdnewlccmdchardelcmdchardelcmdechocmdechocquotexxescsphdradixbraceyxunhexxchknumscyxlowersnlookuptablecmdnxcmdlenlenvixlookuptablecmdnxcmdlenicmdsquoxcmdgquoatxnungwnpppbprecallrlastcurrentcmprxxcmpromfilbufatybufinworddpxpsetfquotinglinebeginblocklvlccckucmd.cckuus2.ockuus2.cvaxpcc2_hlp1usage_tophlp_hxxinp_hxyxyz_hmxxbye_hmxxclo_hmxxminp_hmxxcon_hmxxget_hmxxlg_hmxxlogi_hmxxrc_hmxxsen_hmxxrsen_hmxxrget_hmxxpsen_hmssmse_hmssadd_hmxxser_hmhset_hmhskey_hmxychkt_hmxyqctl_hxymodm_hmxydial_hmxyflo_hmxyf_hmxyhsh_hsetsrv_hmhrmt_ifhlp_hmxxeval_ifxhlp_forhlp_whihlp_swihlp_openhlp_hxxaskq_hxxask_hxxgetc_hxxdef_hxxass_hxxdec_hxxinc_hxyexit_hxxpau_hxxmsl_hxxshe_hxxxmit_hxxwai_hxxwri_hxxlook_hxxansw_hxxdialdohlpxxyxhmsgsxhmsgasnkjiyx_hsetxmit_hsetbkg_hsetbuf_hsetcmd_hsetcar_hsetat_hxyinp_hxytak_hxyterm_hxymacr_hmxyprm_hxywind_hxyrpt_hxyrcv_hxysnd_hxyxferdohsetxxx_hrsetdohrmtxxxhrsethxyxferhxysndhxyrcvhxyrpthxywindhmxyprmhxymacrhxytermhxytakhxyinphsetathsetcarhsetcmdhsetbufhsetbkghsetxmithxxdialhxxanswhxxlookhxxwrihxxwaihxxxmithxxshehxxmslhxxpauhxyexithxxinchxxdechxxasshxxdefhxxgetchxxaskhxxaskqopenhlpswihlpwhihlpforhlpifxhlphmxxevalifhlphmhrmthsetsrvhmxyhshhmxyfhmxyflohmxydialhxymodmhmxyqctlhmxychkthmhskeyhmhsethmxxserhmssaddhmssmsehmxxpsenhmxxrgethmxxrsenhmxxsenhmxxrchmxxlogihmxxlghmxxgethmxxconhmxxminphmxxclohmxxbyehxyxyzhxxinptophlphlp1ckuus2.cckuus3.ockuus3.cvaxpcc2_pfxtab_logintab_sfttab_nsfttab_drstrtab_dcnvtab_xittab_ifdtab_taktab_suftab_smactab_scrtab_xfrmtab_parsdirparsdirparsdircxdirsepcmaxfnpdirpathppxdirsnxdirddyxi_ckloginckloginckloginaccountpasswordusernamesxsetflowbitsp_setdcdsetdcdsetdcdzyxgetyesnomsgzydochkyx_dialstrdialstrdialstrpmsgsxinitmdmxmpsetmodem_setdialzzzyxsetdialsetdialykpinszxshomodemzzcnxp_mdays_setalarmsetalarmsetalarmxxylastdaydzzsxddmmyyyyset_keyskcflagyx_protofieldprotofieldprotofieldcurrenthelppxxtmpbufs_setprotosetprotosetprotop6p5p4p3p2p1s6s5s4s3s2s1yxsetdestyxdoprmxxrmsflgsbsrbsbzzptnowpnowzzszzzyxihupokxneedwarnzyshoctlixfrmtabscrtabsmactabtaktabifdtabxittabdcnvtabdrstrtabnsfttabsfttablogintabpfxtabmdaysckuus3.cckuus4.ockuus4.cvaxpcc2_hexdigits_wkdays_months_r3prescanyyxstakepathypxyargvyargc_tr_inttrtrapfoogettcscs1cs2doconectqqsavexgmdmtypxitransmitstnistuffsnpmybinarymyflowicxzzzoldsigdologxfnpsdispypktopnsdispxxtraopnsdispxxsesopnsdispxxdebopnsdispxxtpgfmodebinarysshoparczzsishonetshodialshodsscdoshodialiishoparfisshoparpsshopardostateffecps_conbuf_concnt_sesbuf_sescnt_myflshmyflshmyflshdoinputtimomsjburstcsxplastcharmianycharicnrttiyxdoreinptimosjcxqxpxxiyxyystringss2newx_ipabuf_getipgetipgetipsstatedpic_fnevalfnevalfnevalfnargpargnxpjapdvbicjxjpiifcsavtstartlxpcs2startstarticdonecc2c1qqqchkval2val1spcbpyxnlen3len2len1kji_ndatbufzzndatexpnvlookstscmpzyxzzstringss2napdepthargpvnambufr3pr2rqpnewvpvbarglvbidn2argnkpppyxtr_intr3monthswkdayshexdigitsndatbufipabufsescntsesbufconcntconbufckuus4.cckuus5.ockuus5.cvaxpcc2_nulcmd_i_textmacinii_cmdinitedcmdiniivnambufzyxidoinitixgetncmsns2ppkpydomacnamedefflagsmxgetnctsnfflagbclastcommalp3lp2lps2cclcccbuflenleniparsermxsplencbpinlevelzzyyxxtfcode_obn_obuf_obp_xxoutxxoutxxoutobufobsizerci_obocobocoboccfreelocalmtvvdolocalprevvlistszxidooutputsstuff2stuffquoteyxxxheraldsxmlooktablecmdncmdlenvimxlooktablecmdncmdleniaddmmacnamspyxiaddmacnamdefqqcpdeflennamlenzyxidelmacnamqcpzxiinitmacjipopclvlqivdostopdoclslogxy_nm_slcshowoffxshovershofealinesflagshotcscslcsrshostrdefschshokeycodecxkmxkmkmschshotrmsdoshowxcbufrspsflpszziyshmdmlinshomacs1s2ppnxshoatt_xerror_cp_tokval_curtok_expval_windexwindexwindexsc_gettokgettokgettokdigradixtptbuf_exponexponexponxysignresult_factorfactorfactor_simpleoldval_termptermptermpopoldval_factfactfactxresult_termtermterm_gcdgcdgcdxytnshift_exprpexprpexprpopoldval_exprexprexpr_xparsexparsexparseevalasvp_simplestsimplestsimplest_simplersimplersimplersimplesimpleopdclarrayann2iparraynamsscnsxbufssbufvnbufvnpsxpsxppyichkarrayaixparsevarscizyxpvarvalsvypnamevalbufincvarsxznvalbufxwordssmaxlistflagmacrozykibpdodoxsflagsy_flitlitcmdsrcdestpppsslpsppbcdocdsxfixcmdprtoptlinessiyxcmdinitedi_textnulcmdflitexpvalcurtoktokvalcpxerrorslcnmobpobufobnckuus5.cckuus6.ockuus6.cvaxpcc2_x_y_z_s_pdoaskcxtmpvnpvnambufsv_recalldoincrcxvnambufdodefcxtvnpvnambuf_dn_p_dn_p2_dn_x_dncountgetdnamegetdnumnchk_acibufcp_dncvtdncvtdncvtkcxp2p2p2p2ybufxbufoutbufacptracbufccccbufsfxnprlacpppxopsswhatnji_ddcvtddcvtddcvtsfnrcxf2infos2lineludialscxconvertlinefppinfoambiguousoldflgpassnewentryoldentrynewdirolddirtjn3n2n1dd_dscopydodialcxnnsv_recallntjs3pliterallenpreviouspartialsparityxidotypefilesavecrcnamedodirdcdoenableyxdodelzldoelsedoswitchaplpdoforapfzfyfxdobugntod2sectssmmhht2dopauscxtnowpnowmdmsigzzdorenamdoreturnspxdoopenfcbszyxdogetcxcbprcyxdogtacxpmbufcidogotoscxtpxpflagmilptmplblstopflgbczyxjibrstrippxchkvarsxtczdoifcxtn2n1d2d1ieppqpszyxdotakesdscopydncountdn_xdn_p2dn_ppszyxckuus6.cckuus7.ockuus7.cvaxpcc2_x_y_z_s_rfttab_nrfttyp_uidflag_vartyp_nvartyp_timotab_rfiltab_neoftab_trmtab_apctab_fdtabsetonprmyxsetnumprmxymaxsetccdfltvarhlpmsgcyxdoxdiszxsetfilrmsflgbuffnpsxsettrmsetsrxxrmsflgbuftmaxtminsetxmitrmsg_remcfmremcfmremcfmcsx_remtxtremtxtremtxtpqscpposbposxidormtxxp3p2p1bufbufbufbufs2sbufsretcodeyxrfilopstsetatrmsflgxxsetinpsetlinxxzzservicesrvbufsavkeysnamedispchlenbufjisavfilxxtpdosavexxfnpsdispyxfdtabapctabtrmtabneoftabrfiltabtimotabnvartypvartypnrfttyprfttabszyxckuus7.cckuusx.ockuusx.cvaxpcc2_ft_win_cmdstrck_errstrparnamcshomdmysdebulenrdebudlenfatalmsgbldlenstrdestlensetgentypearg1arg2arg3cpupstr_mgbufpfnparsestringxrqspdbchrccpsckhostvvbufvvlengaskmorervctrapsigck_timexptbufstptrapsigtlogfs1s2nxspschkintzzofdcnchintmsgn_newdpy_fbuf_abuf_oldffc_dots_hpos_dpyinitdpyinitdpyinitshowpktcmytfcpstppdetbufferkihowfarscreenfcnslenbufermsgmsgdocleancmdkdoexitexitstatwhatsetintbgchk_dbptrdodebugfs1s2nspdbptrhposdotsoldffcabuffbufnewdpymgbufpcmdstrft_winckuusx.cckuusy.ockuusy.cvaxpcc2_pmsgpmsgpmsgs_fmsgfmsgfmsgsfatal2msg1msg2bufcmdlinxdoargxxpzzzyickuusy.cckuusr.ockuusr.cvaxpcc2_addtab_naddtab_x_y_z_s_clrtab_kmstab_enatab_nena_conntab_looktabdocmdcxxxnextflppctnowpnownssreszzflpxmodefmodeseektoptakepathivwcilistconntabnenaenatabkmstabclrtabszyxnaddtabaddtabckuusr.cckucon.ockucon.cvaxpcc2_apclength_apcbuflen_zmdlok_kmptr_quitnow_jbset_dohangup_sjval_goterr_active_inshift_outshift_parent_id_ecbuf_ecbp_obc_ibuf_obuf_temp_ibp_ibc_obp_xpipe_pid_escseq_inesc_oldescchkaesc_pipemsgpipemsgpipemsgncode_sig_env_forkintforkintforkintfoo_ck_sndmsgck_sndmsgck_sndmsg_con_env_pipeintpipeintpipeintargcode_ckcputfckcputfckcputfxckcputccxckcgetcdummync_kbp_kbc_kbuf_kbgetkbgetkbgetoktries_concldconcldconcldisksignbufk_logcharapcrccconectstuffconretcsavec2cnhconnehlpmsgcdoesccxdlogcharlogcharckbufkbckbpcon_envsig_envoldescinescescseqpidxpipeobpibcibptempobufibufobcecbpecbufparent_idoutshiftinshiftactivegoterrsjvaldohangupjbsetquitnowkmptrzmdlokapcbuflenapclengthckucon.cckudia.ockudia.cvaxpcc2_fail_code_func_code_partial_mymdmtyp_dial_what_nonverbal_mp_escbuf_mdmcapas_xx_ok_CCITT_HAYES_getok_UNKNOWN_ATTISN_ATTMODEM_ATTDTDM_DIGITEL_H_1200_H_ULTRA_H_ACCURA_PPI_DATAPORT_UCOM_AT_ZOOM_ZYXEL_ZOLTRIX_MOTOROLA_BOCA_INTEL_MULTITECH_SUPRA_MAXTECH_ROLM_USR_OLDTB_NEWTB_DUMMY_RWV32_RWV32B_RWV34_MWAVE_TELEPATH_CARDINAL_CERMETEK_DF03_DF100_DF200_GDC_PENRIL_RACAL_VENTEL_CONCORD_MICROCOM_MICROLINK_tries_mdmecho_p_lbuf_rbuf_sjbuf_savalrm_savint_dialtimedialtimedialtimefoo_dialintdialintdialintfoo_ddincddincddincn_ttslowttslowttslowsmillisec_waitforwaitforwaitforsxc_didwegetdidwegetdidwegetsrilr_dresetdresetdreset_spdchgspdchgspdchgss2_dialocdialocdialoccgetdialenviip_dialfaildialfaildialfailxs_waitct_mdmwait_mdmstat_c_telnbr__dodial_dodial_dodialthreadinfohbuftbcmdbufrsss_gethrnyxxxx_gethrwnnxwssc2_faildialfaildialfaildialthreadinfockdialnbrx1x2fcxmmsgspdmaxserperrmsg_okbuf_oktimooktimooktimofoo_okstatus_okn_okstrict_dookdookdookthreadinfoxic_failokfailokfailokthreadinfogetokgetoknstrictgethrngethrnjinbufxcgethrwgethrwconspdscptrdialhupxmdmhupmpsxparityxokstrictoknokstatusokbuftelnbrmdmstatmdmwaitwaitctcsavintsavalrmsjbufrbuflbufpmdmechotriesMICROLINKMICROCOMCONCORDVENTELRACALPENRILGDCDF200DF100DF03CERMETEKCARDINALTELEPATHMWAVERWV34RWV32BRWV32DUMMYNEWTBOLDTBUSRROLMMAXTECHSUPRAMULTITECHINTELBOCAMOTOROLAZOLTRIXZYXELZOOMUCOM_ATDATAPORTPPIH_ACCURAH_ULTRAH_1200DIGITELATTDTDMATTMODEMATTISNUNKNOWNHAYESCCITTxx_okmdmcapasescbufmpnonverbaldial_whatmymdmtyppartialfunc_codefail_codeckudia.cckuscr.ockuscr.cvaxpcc2_scr_echo_exp_alrm_seq_buf_s_got_it_no_cr_alrmrng_scrtimescrtimescrtimefoo_sequencsequencsequencoct_charci_conbuf_concnt_sesbuf_sescnt_myflshmyflshmyflsh_rseqe_rseqgot_rseqtrace_rseql_dorseqdorseqdorseqthreadinfoburstxi_failrseqfailrseqfailrseqthreadinfo_recvseqrecvseqrecvseqlitracegote_oseqret_dooseqdooseqdooseqthreadinfosblfailoseqthreadinfo_outseqoutseqoutseqdelaydologincmdstresavealmflushixnoseqretrseqlrseqtracerseqgotrseqesescntsesbufconcntconbufalrmrngno_crgot_itsseq_bufexp_alrmscr_echockuscr.cckcnet.ockcnet.cvaxpcc2netopennamelclnettnetclosnettchknetfluinetbreaknetinctimonettoccnettolsnckcnet.cckusig.ockusig.cvaxpcc2cc_executesj_bufdofuncfailfuncrcalrm_executesj_buftimohandlerdofuncfailfuncsavhandlersavalrmrccc_alrm_executesj_buftimohandlerdofuncfailfuncsavhandlersavalrmrcckusig.c_exit.oaccess.oalarm.oatoi.oatol.ocerror.ochdir.ochmod.oclose.oclosedir.oclrerr.ocreat.octime.octype.odata.odup.oerrlst.oexecl.oexecv.oexecve.oexit.ofdopen.ofgets.ofilbuf.oflsbuf.ofopen.ofork.ofprintf.ofputs.ofseek.ogetenv.ogetgid.ogetlogin.ogetpid.ogetpwnam.ogetpwuid.ogetuid.ogetwd.oioctl.oisatty.okill.olink.olseek.olstat.omalloc.omkdir.oopen.oopendir.operror.opipe.opopen.oprintf.ordwr.oread.oreaddir.orew.ormdir.osbrk.oselect.osetbuf.osetgid.osetjmp.osetpgrp.osetuid.osignal.osleep.osprintf.ostat.ostrcat.ostrcmp.ostrcpy.ostrlen.ostrncat.ostrncmp.ostrncpy.otime.otolower.otoupper.ottyname.oudiv.ounlink.ourem.outime.owait.owrite.ovfprintf.o_cleanup.o_printnum.oatexit.octtyname.odirread.ofstat.ogetlog.ogetpwent.omemcpy.opdirread.ostrchr.o_dtoa.o_fconv.o_exitstart_main_environ_ck_ver_versio_xvernum_vernum_verwho_copyright_hlptxt_srvtxt_ptab_spsiz_spmax_spsizr_spsizf_rpsiz_urpsiz_maxrps_maxsps_maxtry_wslots_wslotr_wslotn_timeouts_spackets_rpackets_retrans_crunched_wmax_wcur_srvdis_srvtim_timint_pkttim_rtimo_timef_rttflg_mintime_maxtime_npad_mypadn_bctr_bctu_bctl_ebq_ebqflg_rqf_rq_sq_rpt_rptq_rptflg_rptena_xfrcan_xfrchr_xfrnum_epktflg_capas_lpcapb_lpcapr_lpcapu_swcapb_swcapr_swcapu_atcapb_atcapr_atcapu_rscapb_rscapr_rscapu_lscapb_lscapr_lscapu_atenci_atenco_atdati_atdato_atdisi_atdiso_atleni_atleno_atblki_atblko_attypi_attypo_atsidi_atsido_atsysi_atsyso_padch_mypadc_seol_eol_ctlq_myctlq_myrptq_rptmin_whoareu_sysindex_myindex_cksysid_uidbuf_iattr_feol_fblksiz_frecl_frecfm_forg_fcctrl_lf_opts_pktnum_sndtyp_rcvtyp_rsn_rln_size_osize_maxsize_spktl_rpktl_pktpaus_rprintf_rmailf_srvcmd_pktmsg_padbuf_recpkt_rdatap_data_srvptr_mystch_stchr_filehead_filetail_filenext_addlist_filnam_cmdfil_cfilef_ngetpath_getpath_x_user_x_passwd_x_acct_x_login_x_logged_nfils_fsize_wildxpand_clfils_stayflg_ttname_speed_parity_autopar_sosi_flow_autoflow_turn_turnch_duplex_escape_delay_tnlm_mdmtyp_myhost_network_nettype_isinterrupted_tt_rows_tt_cols_tt_escape_exitonclose_tlevel_remonly_protocol_prefixing_carrier_cdtimo_xitsta_fncact_fncsav_bgset_suspend_filcnt_filrej_flci_flco_tlci_tlco_ffc_tfc_ccu_ccp_rptn_tsecs_fsecs_deblog_debses_pktlog_seslog_tralog_displa_stdouf_stdinf_xflg_hcflg_dest_fncnv_f_save_fnspath_fnrpath_binary_b_save_xfermode_sendmode_slostart_cmask_fmask_warn_quiet_local_server_bye_active_cflg_cnflg_cxseen_czseen_discard_keep_unkcs_nakstate_dblchar_moving_sendstart_clcmds_sstate_zstate_cmarg_cmarg2_cmlist_autodl_remfile_rempipe_remappd_remdest_printfile_printpipe_en_cwd_en_cpy_en_del_en_dir_en_fin_en_get_nopush_en_hos_en_ren_en_sen_en_set_en_spa_en_typ_en_who_en_bye_en_asg_en_que_en_ret_en_mai_en_pri_xargv_xargc_xargs_xarg0_pipedata_zinptr_zoutptr_zincnt_zoutcnt_cmjbuf_ckindex_strlen_strncmp_xxstrcmp_isabsolute_dodebug_is_a_tty_isatty_sysidlist_getsysid_strcmp_getsysix_initproto_makestr_free_malloc_strcpy__ctype_tolower_docmdline_proto_conoll_doconect_failcmdline_dotakeini_cmdini_doinit_parser_failtakeini_doexit_doicp_addmac_dodo_maclvl_herald_dotake_failicp_fixcmd_docmdfile_failcmdfile_setprefix_ctlp_prescan_sysinit_fatal_connoi_getiobs_ckhost_dftty_dfloc_dfprty_dfflow_ttopen_conol_ttgspd_inibufs_getdialenv_setint_cc_execute_what_cmdlin_concb_zinbuffer_zoutbuffer_ckxv_ckxsys_dfmdm_ttprty_ttpflg_ttmdm_ttcarr_backgrd_fdflag_ttfdflg_tvtflg_ttspeed_ttflow_ttld_ckxech_ttyfd_telnetfd_x25fd_lmodef_lmode_flfnam_haslock_timerh_ttimoff_longjmp_cc_int_occt_cctrap_ttgwsiz_priv_ini__iob_fprintf_conbgt_congm_signal_syscleanup_ttclos_atoi_strncpy_alarm_setjmp_do_open_errno_perror_close_ttyname_priv_on_priv_off_printf_DIRCMD_sprintf_zsyscmd_ioctl_carrctl_priv_opn_tthang_ttres_msleep_open_read_getpid_creat_unlink_write_chmod_link_kill_ttpkt_ttsspd_ttsetflow_ttvt_congspd_mygetbuf_myfillbuf_ttflui_ttflux_ttfluo_getpgrp_conint_sig_ign_ttchk_ttxin_ttol_ttoc_ttinl_parchk_ttinc_ttsndb_ttsndlb_sleep_select_rtimer_time_gtimer_ztime_localtime_asctime_conbin_conres_conoc_conxo_conola_conchk_coninc_ttscarr_ttgmdm_psuspend_getuid_getgid_geteuid_getegid_setgid_setuid_priv_can_priv_chk_real_uid_ckzv_ckzsys_DELCMD_CPYCMD_RENCMD_PWDCMD_DIRCM2_TYPCMD_SPACMD_SPACM2_WHOCMD_maxnam_maxpath_ck_znewn_fp_mtchs_mtchptr_zkself_getppid_zopeni_chkfn_fopen_clearerr_zopeno_setbuf_zclose_zoutdump_zclosf_fclose_zchin_zinfill__filbuf_zsinl_zxin_fread_zsout_fputs_zsoutl_zsoutx_zchout__flsbuf_fflush_zchki_stat_access_zchko_isdir_zdelet_zrtol_zstrip_zltor_toupper_zchdir_zhome_tilde_expand_chdir_getenv_zgtdir_getwd_zxcmd_popen_pipe_fork_dup2_getpwuid_execl_fdopen_pclose_wait_zxpand_shxpand_znext_zchkspa_znewn_zrename_strcat_zcopy_zsattr_zfcdat_zdtstr_zstrdt_ftime_zstime_utime_zmail_zprint_splitpath_iswild_opendir_readdir_closedir_getpwnam_getlogin__exit_zshcmd_zmkdir_mkdir_zfseek_fseek_zfnqfp_fnsv_crc16_docrc_xfrbel_rf_err_sndsrc_memstr_funcstr_bestlen_maxsend_myinit_encstr_getpkt_putsrv_puttrm_query_qbufn_qbufp_putfil_zdstuff_decode_crctb_crcta_lslook_tinit_justone_numerrs_chktimo_rttinit_winlo_mksbuf_getsbuf_dumpsbuf_mkrbuf_whatru_pktinit_rinit_tlog_spar_rpar_ack1_resetc_cmargbuf_cmargp_fnlist_sinit_gnfile_errpkt_screen_rseqtbl_freerbuf_sipkt_sseqtbl_spack_xsinit_resend_ofn1_ofn2_ofn1x_opnerr_rcvfil_rejection_fspec_oldcps_cps_rs_len_intmsg_reof_success_clsof_reot_tstats_sfile_nxtpkt_openi_sdata_sbufnum_szeof_seof_sxeof_seot_dada_rdebu_dopar_bigsbsiz_adjpkl_whoarewe_sdebu_strncat_sndhlp_nxttype_sndtype_snddir_snddel_cwd_syscmd_remset_bigrbsiz_rcvtimo_rrttbl_srttbl_rttsamples_rttdelay_pktintvl_rttvariance_rttstddev_getrtt_input_r_pkt_dumprbuf_rpack_s_pkt_nack_chkwin_freerpkt_rbufnum_sacktbl_freesbuf_chk1_chk2_chk3_logpkt_ack_ackns_ackn_clsif_scmd_srinit_kstart_chkspkt_zstart_chkint_getrbuf_fstats_optbuf_dum001_sbufuse_dum003_dum002_rbufuse_xbuf_bigsbuf_bigrbuf_bigbufpudiv_makebuf_window_sattr_getreason_rsattr_gattr_atol_initattr_adebu_opena_openo_ck_errstr_canned_opent_wartv_protv_querybuf_state_wart_tbl_dldir_f_tmpdir_savdir_ermsg_doclean_zzstring_fdispla_cmdlvl_fnparse_cmdv_cmdmsk_dfprom_cmflgs_cmfsav_cmdbuf_savbuf_atmbuf_atxbuf_cm_recall_on_recall_in_recall_kwdhelp_cmd_cols_cmd_rows_askmore_sh_sort_cmsetup_cmrini_cmsetp_cmsavp_prompt_pushcmd_cmres_cmini_cmp_cmddep_cmpush_cmpop_untab_cmnum_cmfld_chknum_xxesc_evala_cmofi_cmifi_cmifi2_cmifip_chkvar_cmdir_cmtxt_cmkey_cmkey2_cmkeyx_lookup_ungword_chktok_cmcfm_rdigits_unhex_lower_xlookup_cmdsquo_cmdgquo_usage_newstxt_introtxt_dohlp_hmsga_hmsg_ccntab_xxstring_nrmt_remcmd_dohrmt_nprm_prmtab_dohset_cmd_quoting_DeleteStartupFile_pwbuf_prmbuf_tempdir_ctltab_outptab_chktab_rpttab_crrtab_ncrr_qvtab_nqvt_dbgtab_ndbg_spdtab_nspd_dpxtab_filtab_nfilp_flotab_nflo_hshtab_nhsh_dialcvt_dialcnf_dialcon_dialcq_usermdm_ntollfree_dialtfc_setmdm_nsetmdm_mdmcap_nmdmcap_dialtab_ndial_mdmhang_dial_str_ndstr_dial_fc_dial_m_wildtab_partbl_npar_onoff_nexit_xitwtab_nexitw_rltab_nrlt_scmdtab_nbytt_srvtab_nsrvt_tstab_nts_lstab_nls_ftrtab_nftr_desttab_ndests_ndialdir_dialdir_tmpbuf_setflow_dialcapas_modemp_dialfc_getyesno_psave_nyesno_yesno_dochk_line_msgflg_brstrip_initmdm_dialec_dialdc_mdmspd_gmdmtyp_dialini_dialmstr_dialmprmt_dialcmd_dialdcon_dialdcoff_dialecon_dialecoff_dialhcmd_dialhwfc_dialswfc_dialnofc_dialtone_dialpulse_dialname_dialmax_dialesc_setmodem_nmdm_mdmtab_dialmhu_dialudt_dialhng_seton_dialnpr_dialksp_dialtmo_mdmwaitd_setnum_dialdpy_dialaaon_dialaaoff_dialmth_dialrtr_dialint_diallac_diallcc_dialldp_dialixp_dialtfp_zzndate_dialixs_diallds_dialpxx_dialpxi_dialpxo_dialsfx_dialsrt_dialrstr_shomodem_shmdmlin_shods_ck_alarm_alrm_date_alrm_time_set_key_x_ifnum_keymap_macrotab_shokeycode_protos_nprotos_setdest_doprm_setat_setgen_setinp_setlin_bgchk_count_inpcas_cm_retry_xaskmore_docd_doclslog_debopn_setcc_xitwarn_setfil_mecho_merror_ckprompt_tp_techo_takerr_secho_settrm_setsr_sessft_lp_pflag_doxdis_setxmit_pacing_tod2sec_hupok_shoctl_vartab_nvars_fnctab_nfuncs_vvbuf_disptb_kermrc_noinit_rcflag_trtrap_gettcs_conect_cmdstk_apcbuf_domac_apcactive_apcstatus_mdmsav_transmit_xmitw_xmitx_xmitf_xmitl_xmits_xmitbuf_dolog_pktopn_sesopn_traopn_pktfil_trafil_sesfil_debfil_gfmode_shoparc_ttnproto_parnam_shonet_shodial_doshodial_dialsta_dialnum_shoparf_colxtab_ncolx_shoparp_showoff_shopar_dostat_instatus_doinput_inecho_m_found_incount_inchar_inpbp_inbufsize_inpbuf_insilence_doreinp_yystring_fnval_g_var_m_arg_arraynam_chkarray_a_dim_a_ptr_nmac_mactab_mlook_ifc_mrval_nvlook_macargc_tfnam_inidir_evalbuf_tfline_modemmsg_localhead_localtail_localnext_tfile_noherald_m_ibm_m_fat_m_fast_m_cautious_m_robust_for_def_whil_def_sw_def_xif_def_ifcmd_iftest_intime_macp_macx_lblbuf_homdir_numbuf_macini_ms_initmac_addmmac_dclarray_getncm_popclvl_getnct_fgets_dirline_stptrap_trap_dostop_repars_toktab_ncmd_cmdtab_docmd_freelocal_dolocal_xwords_parsevar_delmac_dooutput_mxlook_shover_userv_connv_dialv_loginv_shofea_prtopt_shotcs_shostrdef_shotrm_tt_crd_doshow_shomac_shoatt_shomdm_xmitp_varval_incvar_varnam_litcmd_cwdf_readblock_readbuf_readsize_mstab_nms_opntab_nopn_iftab_nif_not_ifargs_ifcond_ifcp_doask_doincr_dodef_d_name_getdname_getdnum_chk_ac_tttapi_ludial_dodial_dialatmo_ckdial_dotype_dodir_doenable_dodel_doelse_doswitch_dofor_dobug_dopaus_dorenam_doreturn_dogta_doopen_doget_dogoto_rewind_doif_tapilinetab_ntapiline_fttab_nfttyp_xmitab_nxmit_nrfilp_eoftab_fntab_nfntab_ntrm_crdtab_fbtab_nfbtyp_nfdtab_rsrtab_nrsrtab_srtab_nsrtab_rmstab_nrms_attrtab_natr_inptab_ninp_intimt_incast_nabltab_rmsg_dormt_rfilop_indef_mdmhup_savkeys_dosave_action_msfiles_sys_errlist_bldlen_dbchr_i_active_ck_time_showpkt_fatal2_doarg_filesinlist_activecmd_savtab_nsav_logtab_nlog_writab_nwri_nclear_clstab_ncls_shotab_nsho_mackey_dologin_rmdir_chkaes_pause_ckcputc_ckcgetc_doesc_hconne_telephony_is_rockwell_is_hayeshispd_mdmname_tb_name_fbuf_dialhup_cc_alrm_execute_alrm_execute_failoseq_flushi_cknetv_ttnet_tn_init_tn_exit_tn_duplex_tn_term_tn_nlm_tn_binary_tn_b_nlm_tn_b_meu_tn_b_ume_netopen_netclos_nettchk_netflui_netbreak_netinc_nettoc_nettolcerror_ctime_gmtime_dysize__sibuf__sobuf__lastbuf_dup_sys_nerr_execv_execve__cleanup_lseek__setcleanup__stdioclean_atexit_vfork_vfprintfurem_getlogname_cttyname_setpwent_getpwent_endpwent_fstat_lstat_getcwd_sbrk_ialloc_realloc_mstats__printnum_ppopen_vepopen_fwrite_dirread_pdirread_end_brk_setpgrp__ttyname_strchr_memcpy__dtoa__atexitfns_setlogname_pwdecode_mb_ncnv__Bfree__d2b__tens__Balloc__bigtens__i2b__pow5mult__mult__hi0bits__lshift__cmp__multadd__diff__tinytens